Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CALM3Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlCALM3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Rabbit CALM3 Polyclonal Antibody | anti-CALM3 antibody

CALM3 antibody - N-terminal region

Gene Names
CALM3; CaM; CALM; CAM1; CAM2; CAMB; PHKD; PHKD3; CaMIII; HEL-S-72
Reactivity
Human, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CALM3; Polyclonal Antibody; CALM3 antibody - N-terminal region; anti-CALM3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGN
Sequence Length
112
Applicable Applications for anti-CALM3 antibody
Western Blot (WB)
Homology
Human: 100%; Pig: 100%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CALM3Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlCALM3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Western Blot (WB) (Host: RabbitTarget Name: CALM3Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlCALM3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Western Blot (WB)

(Host: RabbitTarget Name: CALM3Sample Type: Human HepG2Antibody Dilution: 1.0ug/mlCALM3 is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (Host: RabbitTarget Name: CALM3Sample Type: Human HepG2Antibody Dilution: 1.0ug/mlCALM3 is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB)

(Host: RabbitTarget Name: CALM3Sample Type: Human JurkatAntibody Dilution: 1.0ug/mlCALM3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat)

Western Blot (WB) (Host: RabbitTarget Name: CALM3Sample Type: Human JurkatAntibody Dilution: 1.0ug/mlCALM3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat)

Western Blot (WB)

(Host: RabbitTarget Name: CALM3Sample Type: Human MCF7Antibody Dilution: 1.0ug/mlCALM3 is strongly supported by BioGPS gene expression data to be expressed in MCF7)

Western Blot (WB) (Host: RabbitTarget Name: CALM3Sample Type: Human MCF7Antibody Dilution: 1.0ug/mlCALM3 is strongly supported by BioGPS gene expression data to be expressed in MCF7)
Related Product Information for anti-CALM3 antibody
This is a rabbit polyclonal antibody against CALM3. It was validated on Western Blot

Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-CALM3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
808
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12kDa
NCBI Official Full Name
calmodulin 3 (phosphorylase kinase, delta), isoform CRA_c
NCBI Official Synonym Full Names
calmodulin 3
NCBI Official Symbol
CALM3
NCBI Official Synonym Symbols
CaM; CALM; CAM1; CAM2; CAMB; PHKD; PHKD3; CaMIII; HEL-S-72
NCBI Protein Information
calmodulin-3
UniProt Protein Name
Calmodulin
UniProt Gene Name
CALM1
UniProt Synonym Gene Names
CALM; CAM; CAM1; CaM
UniProt Entry Name
CALM_HUMAN

NCBI Description

This gene encodes a member of a family of proteins that binds calcium and functions as a enzymatic co-factor. Activity of this protein is important in the regulation of the cell cycle and cytokinesis. Multiple alternatively spliced transcript variants have been observed at this gene. [provided by RefSeq, Aug 2016]

Uniprot Description

Calmodulin: a calcium-binding small regulatory protein that mediates the control of a large number of enzymes by Ca(2+). Among the enzymes to be stimulated by the calmodulin-Ca(2+) complex are a number of protein kinases and phosphatases. Has four functional calcium-binding domains. Phosphorylation and ubiquitination result in a decreased activity.

Protein type: Calcium-binding

Chromosomal Location of Human Ortholog: 14q32.11

Cellular Component: nucleoplasm; spindle pole; centrosome; sarcomere; growth cone; spindle microtubule; cytoplasm; plasma membrane; extracellular region; cytosol; nucleus; vesicle

Molecular Function: protein domain specific binding; nitric-oxide synthase regulator activity; titin binding; calcium ion binding; calcium-dependent protein binding; protein kinase binding; protein serine/threonine kinase activator activity; protein binding; N-terminal myristoylation domain binding; phospholipase binding; thioesterase binding; type 3 metabotropic glutamate receptor binding; phosphoinositide 3-kinase binding; nitric-oxide synthase binding; adenylate cyclase binding

Biological Process: positive regulation of phosphoprotein phosphatase activity; phototransduction, visible light; inositol phosphate metabolic process; nerve growth factor receptor signaling pathway; pathogenesis; signal transduction; nitric oxide metabolic process; positive regulation of protein amino acid dephosphorylation; synaptic transmission; substantia nigra development; platelet degranulation; muscle contraction; positive regulation of cyclic nucleotide metabolic process; response to corticosterone stimulus; epidermal growth factor receptor signaling pathway; mitochondrion organization and biogenesis; platelet activation; fibroblast growth factor receptor signaling pathway; glycogen catabolic process; regulation of heart rate; positive regulation of nitric-oxide synthase activity; organelle organization and biogenesis; adenylate cyclase activation; response to amphetamine; glucose metabolic process; positive regulation of protein amino acid autophosphorylation; regulation of cytokinesis; rhodopsin mediated signaling; G-protein coupled receptor protein signaling pathway; regulation of rhodopsin mediated signaling; phospholipase C activation; carbohydrate metabolic process; innate immune response; positive regulation of cyclic-nucleotide phosphodiesterase activity; detection of calcium ion; regulation of nitric-oxide synthase activity; blood coagulation; response to calcium ion; vascular endothelial growth factor receptor signaling pathway

Disease: Long Qt Syndrome 14; Ventricular Tachycardia, Catecholaminergic Polymorphic, 4

Research Articles on CALM3

Similar Products

Product Notes

The CALM3 calm1 (Catalog #AAA3214429) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CALM3 antibody - N-terminal region reacts with Human, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CALM3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CALM3 calm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LQDMINEVDA DGNGTIDFPE FLTMMARKMK DTDSEEEIRE AFRVFDKDGN. It is sometimes possible for the material contained within the vial of "CALM3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.