Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CACNB3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysateCACNB3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Rabbit CACNB3 Polyclonal Antibody | anti-CACNB3 antibody

CACNB3 antibody - N-terminal region

Gene Names
CACNB3; CAB3; CACNLB3
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CACNB3; Polyclonal Antibody; CACNB3 antibody - N-terminal region; anti-CACNB3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MYDDSYVPGFEDSEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQ
Sequence Length
447
Applicable Applications for anti-CACNB3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 92%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the n terminal region of human CACNB3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CACNB3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysateCACNB3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Western Blot (WB) (WB Suggested Anti-CACNB3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysateCACNB3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)
Related Product Information for anti-CACNB3 antibody
This is a rabbit polyclonal antibody against CACNB3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.
Product Categories/Family for anti-CACNB3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
784
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
CAB3b
NCBI Official Synonym Full Names
calcium voltage-gated channel auxiliary subunit beta 3
NCBI Official Symbol
CACNB3
NCBI Official Synonym Symbols
CAB3; CACNLB3
NCBI Protein Information
voltage-dependent L-type calcium channel subunit beta-3
UniProt Protein Name
Voltage-dependent L-type calcium channel subunit beta-3
UniProt Gene Name
CACNB3
UniProt Synonym Gene Names
CACNLB3; CAB3
UniProt Entry Name
CACB3_HUMAN

NCBI Description

This gene encodes a regulatory beta subunit of the voltage-dependent calcium channel. Beta subunits are composed of five domains, which contribute to the regulation of surface expression and gating of calcium channels and may also play a role in the regulation of transcription factors and calcium transport. [provided by RefSeq, Oct 2011]

Uniprot Description

CACNB3: The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting. Belongs to the calcium channel beta subunit family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Channel, calcium

Chromosomal Location of Human Ortholog: 12q13

Cellular Component: membrane; apical plasma membrane; voltage-gated calcium channel complex; cytosol

Molecular Function: voltage-gated calcium channel activity; high voltage-gated calcium channel activity; protein kinase binding

Biological Process: membrane depolarization; axon guidance; synaptic transmission; transport; calcium ion transport; T cell receptor signaling pathway; neuromuscular junction development

Research Articles on CACNB3

Similar Products

Product Notes

The CACNB3 cacnb3 (Catalog #AAA3202373) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CACNB3 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CACNB3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CACNB3 cacnb3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MYDDSYVPGF EDSEAGSADS YTSRPSLDSD VSLEEDRESA RREVESQAQQ. It is sometimes possible for the material contained within the vial of "CACNB3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.