Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of U-87MG cells, using CACNA1B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)

Rabbit anti-Human CACNA1B Polyclonal Antibody | anti-CACNA1B antibody

CACNA1B Rabbit pAb

Gene Names
CACNA1B; BIII; CACNN; Cav2.2; CACNL1A5
Reactivity
Human
Applications
Western Blot
Purity
Affinity purification
Synonyms
CACNA1B; Polyclonal Antibody; CACNA1B Rabbit pAb; BIII; CACNL1A5; CACNN; Cav2.2; DYT23; anti-CACNA1B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
SITYKTANSSPIHFAGAQTSLPAFSPGRLSRGLSEHNALLQRDPLSQPLAPGSRIGSDPYLGQRLDSEASVHALPEDTLTFEEAVATNSGRSSRTSYVSSLTSQSHPLRRVPNGYHCTLGLSSGGRARHSYHHPDQDHWC
Applicable Applications for anti-CACNA1B antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 2200 to the C-terminus of human CACNA1B (NP_000709.1).
Positive Samples
U-87MG
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of U-87MG cells, using CACNA1B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)

Western Blot (WB) (Western blot analysis of extracts of U-87MG cells, using CACNA1B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)
Related Product Information for anti-CACNA1B antibody
Background: The protein encoded by this gene is the pore-forming subunit of an N-type voltage-dependent calcium channel, which controls neurotransmitter release from neurons. The encoded protein forms a complex with alpha-2, beta, and delta subunits to form the high-voltage activated channel. This channel is sensitive to omega-conotoxin-GVIA and omega-agatoxin-IIIA but insensitive to dihydropyridines. Two transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-CACNA1B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
774
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
251,716 Da
NCBI Official Full Name
voltage-dependent N-type calcium channel subunit alpha-1B isoform 1
NCBI Official Synonym Full Names
calcium channel, voltage-dependent, N type, alpha 1B subunit
NCBI Official Symbol
CACNA1B
NCBI Official Synonym Symbols
BIII; CACNN; Cav2.2; CACNL1A5
NCBI Protein Information
voltage-dependent N-type calcium channel subunit alpha-1B; Cav2.2 voltage-gated Ca2+ channel; brain calcium channel III; calcium channel alpha12.2 subunit; calcium channel, L type, alpha-1 polypeptide; calcium channel, N type; calcium channel, voltage-dep
UniProt Protein Name
Voltage-dependent N-type calcium channel subunit alpha-1B
UniProt Gene Name
CACNA1B
UniProt Synonym Gene Names
CACH5; CACNL1A5; BIII
UniProt Entry Name
CAC1B_HUMAN

Similar Products

Product Notes

The CACNA1B cacna1b (Catalog #AAA9142410) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CACNA1B Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CACNA1B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the CACNA1B cacna1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SITYKTANSS PIHFAGAQTS LPAFSPGRLS RGLSEHNALL QRDPLSQPLA PGSRIGSDPY LGQRLDSEAS VHALPEDTLT FEEAVATNSG RSSRTSYVSS LTSQSHPLRR VPNGYHCTLG LSSGGRARHS YHHPDQDHWC. It is sometimes possible for the material contained within the vial of "CACNA1B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.