Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (CA1 rabbit polyclonal antibody. Western Blot analysis of CA1 expression in human colon.)

Rabbit anti-Human, Mouse CA1 Polyclonal Antibody | anti-CA1 antibody

CA1 (Carbonic Anhydrase 1, Carbonic Anhydrase I, CA-I, Carbonate Dehydratase I, Carbonic Anhydrase B, CAB) (Biotin)

Gene Names
CA1; CAB; CA-I; Car1; HEL-S-11
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CA1; Polyclonal Antibody; CA1 (Carbonic Anhydrase 1; Carbonic Anhydrase I; CA-I; Carbonate Dehydratase I; Carbonic Anhydrase B; CAB) (Biotin); anti-CA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CA1. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-CA1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CA1, aa1-261 (NP_001729.1).
Immunogen Sequence
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(CA1 rabbit polyclonal antibody. Western Blot analysis of CA1 expression in human colon.)

Western Blot (WB) (CA1 rabbit polyclonal antibody. Western Blot analysis of CA1 expression in human colon.)

Western Blot (WB)

(Western Blot analysis of CA1 expression in transfected 293T cell line by CA1 polyclonal antibody. Lane 1: CA1 transfected lysate (28.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CA1 expression in transfected 293T cell line by CA1 polyclonal antibody. Lane 1: CA1 transfected lysate (28.9kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CA1 antibody
Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA1 is closely linked to CA2 and CA3 genes on chromosome 8, and it is a cytosolic protein which is found at the highest level in erythrocytes.
Product Categories/Family for anti-CA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
759
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,870 Da
NCBI Official Full Name
carbonic anhydrase 1 isoform a
NCBI Official Synonym Full Names
carbonic anhydrase I
NCBI Official Symbol
CA1
NCBI Official Synonym Symbols
CAB; CA-I; Car1; HEL-S-11
NCBI Protein Information
carbonic anhydrase 1; carbonic anhydrase B; carbonate dehydratase I; epididymis secretory protein Li 11
UniProt Protein Name
Carbonic anhydrase 1
UniProt Gene Name
CA1
UniProt Synonym Gene Names
CAB; CA-I
UniProt Entry Name
CAH1_HUMAN

NCBI Description

Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. This CA1 gene is closely linked to the CA2 and CA3 genes on chromosome 8. It encodes a cytosolic protein that is found at the highest level in erythrocytes. Allelic variants of this gene have been described in some populations. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014]

Uniprot Description

CA1: Reversible hydration of carbon dioxide. Can hydrates cyanamide to urea. Belongs to the alpha-carbonic anhydrase family.

Protein type: EC 4.2.1.1; Lyase; Energy Metabolism - nitrogen

Chromosomal Location of Human Ortholog: 8q21.2

Cellular Component: cytosol

Molecular Function: carbonate dehydratase activity; zinc ion binding

Biological Process: bicarbonate transport; one-carbon compound metabolic process

Research Articles on CA1

Similar Products

Product Notes

The CA1 ca1 (Catalog #AAA6371785) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CA1 (Carbonic Anhydrase 1, Carbonic Anhydrase I, CA-I, Carbonate Dehydratase I, Carbonic Anhydrase B, CAB) (Biotin) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CA1 ca1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.