Mouse anti-Human CA1 Monoclonal Antibody | anti-CA1 antibody

CA1 (Carbonic Anhydrase 1, Carbonic Anhydrase I, CA-I, Carbonate Dehydratase I, Carbonic Anhydrase B, CAB) (FITC)

Cat. Num. AAA6146209

• Gene Names: CA1; CAB; CA-I; Car1; HEL-S-11
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation, Western Blot
• Purity: Purified
• Synonyms: CA1; Monoclonal Antibody; CA1 (Carbonic Anhydrase 1; Carbonic Anhydrase I; CA-I; Carbonate Dehydratase I; Carbonic Anhydrase B; CAB) (FITC); anti-CA1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: M1
• Specificity: Recognizes human CA1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-CA1 antibody: ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant protein corresponding to aa1-261 from human CA1 (AAH27890) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (54.45kD), using 124177.)

Western Blot (WB)

(Western Blot analysis of CA1 expression in human spleen using 124177)

Western Blot (WB)

(Western Blot analysis of CA1 expression in transfected 293T cell line using 124177. Lane 1: CA1 transfected lysate (28.9kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of CA1 transfected lysate using 124177 and Protein A Magnetic Bead and immunoblotted with CA1 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged CA1 is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(CA1 monoclonal antibody, Western Blot analysis of CA1 expression in HeLa.)

Related Product Information for anti-CA1 antibody

Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA1 is closely linked to CA2 and CA3 genes on chromosome 8, and it is a cytosolic protein which is found at the highest level in erythrocytes.

Product Categories/Family for anti-CA1 antibody

Antibodies; Enzymes

NCBI and Uniprot Product Information

• NCBI GI #: 20380765
• NCBI GeneID: 759
• Molecular Weight: 28,870 Da
• NCBI Official Full Name: Homo sapiens carbonic anhydrase I, mRNA
• NCBI Official Synonym Full Names: carbonic anhydrase 1
• NCBI Official Symbol: CA1
• NCBI Official Synonym Symbols: CAB; CA-I; Car1; HEL-S-11
• NCBI Protein Information: carbonic anhydrase 1
• Protein Family: Cation-transporting ATPase

NCBI Description

Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. This CA1 gene is closely linked to the CA2 and CA3 genes on chromosome 8. It encodes a cytosolic protein that is found at the highest level in erythrocytes. Allelic variants of this gene have been described in some populations. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014]