Western Blot (WB)
(C9ORF96 antibody (MBS5302465) used at 2.5 ug/ml to detect target protein.)
Rabbit C9ORF96 Polyclonal Antibody | anti-C9ORF96 antibody
C9ORF96 antibody
Gene Names
STKLD1; Sk521; SgK071; C9orf96
Applications
Western Blot
Purity
Total IgG Protein A purified
Synonyms
C9ORF96; Polyclonal Antibody; C9ORF96 antibody; Polyclonal C9ORF96; Anti-C9ORF96; Chromosome ORF 9; RP11-244N20.8; MGC43306; Chromosome 9 ORF; Chromosome ORF-9; anti-C9ORF96 antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
C9ORF96 antibody was raised against the C terminal Of C9Orf96
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of C9ORF96 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
335
Applicable Applications for anti-C9ORF96 antibody
Western Blot (WB)
Application Notes
WB: 2.5 ug/ml
Biological Significance
C9ORF96 may be a serine/threonine protein kinase.
Cross-Reactivity
Human
Immunogen
C9ORF96 antibody was raised using the C terminal Of C9Orf96 corresponding to a region with amino acids AFKVVVQEEGGSGLSLIKETYQLHRDDPEVVENVGMLLVHLASYEEILPE
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(C9ORF96 antibody (MBS5302465) used at 2.5 ug/ml to detect target protein.)
Western Blot (WB)
(C9ORF96 antibody (MBS5302465) used at 2.5 ug/ml to detect target protein.)
Related Product Information for anti-C9ORF96 antibody
Rabbit polyclonal C9ORF96 antibody raised against the C terminal Of C9Orf96
Product Categories/Family for anti-C9ORF96 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
76 kDa (MW of target protein)
NCBI Official Full Name
chromosome 9 open reading frame 96, isoform CRA_g
NCBI Official Synonym Full Names
serine/threonine kinase-like domain containing 1
NCBI Official Symbol
STKLD1
NCBI Official Synonym Symbols
Sk521; SgK071; C9orf96
NCBI Protein Information
serine/threonine kinase-like domain-containing protein STKLD1
UniProt Protein Name
Serine/threonine kinase-like domain-containing protein STKLD1
UniProt Gene Name
STKLD1
UniProt Synonym Gene Names
C9orf96; SGK071
UniProt Entry Name
STKL1_HUMAN
Uniprot Description
STKLD1: Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. STKL subfamily. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Protein kinase, Other; Kinase, protein; Motility/polarity/chemotaxis; EC 2.7.11.1; Protein kinase, Ser/Thr (non-receptor); Other group; Other-Unique family
Chromosomal Location of Human Ortholog: 9q34.2
Molecular Function: ATP binding; protein kinase activity
Biological Process: protein amino acid phosphorylation
Research Articles on C9ORF96
Similar Products
Product Notes
The C9ORF96 stkld1 (Catalog #AAA5302465) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's C9ORF96 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 2.5 ug/ml. Researchers should empirically determine the suitability of the C9ORF96 stkld1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C9ORF96, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
