Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged C9orf96 is 0.1 ng/ml as a capture antibody.)

Mouse C9orf96 Monoclonal Antibody | anti-C9orf96 antibody

C9orf96 (Chromosome 9 Open Reading Frame 96, MGC43306, RP11-244N20.8) (AP)

Gene Names
STKLD1; Sk521; SgK071; C9orf96
Applications
Western Blot
Purity
Purified
Synonyms
C9orf96; Monoclonal Antibody; C9orf96 (Chromosome 9 Open Reading Frame 96; MGC43306; RP11-244N20.8) (AP); Chromosome 9 Open Reading Frame 96; RP11-244N20.8; anti-C9orf96 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3G3
Specificity
Recognizes C9orf96.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-C9orf96 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
C9orf96 (NP_714921, 1aa-99aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MLGPGSNRRRPTQGERGPGSPGEPMEKYQVLYQLNPGALGVNLVVEEMETKVKHVIKQVECMDDHYASQALEELMPLLKLRHAHISVYQELFITWNGEI
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged C9orf96 is 0.1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged C9orf96 is 0.1 ng/ml as a capture antibody.)
Related Product Information for anti-C9orf96 antibody
Mouse monoclonal antibody raised against a partial recombinant C9orf96.
Product Categories/Family for anti-C9orf96 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,767 Da
NCBI Official Full Name
serine/threonine kinase-like domain-containing protein STKLD1
NCBI Official Synonym Full Names
serine/threonine kinase-like domain containing 1
NCBI Official Symbol
STKLD1
NCBI Official Synonym Symbols
Sk521; SgK071; C9orf96
NCBI Protein Information
serine/threonine kinase-like domain-containing protein STKLD1; probable inactive protein kinase-like protein SgK071; serine/threonine kinase-like domain-containing protein 1; sugen kinase 071
UniProt Protein Name
Serine/threonine kinase-like domain-containing protein STKLD1
UniProt Gene Name
STKLD1
UniProt Synonym Gene Names
C9orf96; SGK071
UniProt Entry Name
STKL1_HUMAN

Similar Products

Product Notes

The C9orf96 stkld1 (Catalog #AAA6164313) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's C9orf96 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the C9orf96 stkld1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C9orf96, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.