Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-C6orf173 Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysate)

Rabbit C6orf173 Polyclonal Antibody | anti-CENPW antibody

C6orf173 antibody - N-terminal region

Gene Names
CENPW; CUG2; CENP-W; C6orf173
Reactivity
Guinea Pig, Horse, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
C6orf173; Polyclonal Antibody; C6orf173 antibody - N-terminal region; anti-CENPW antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Horse, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFV
Sequence Length
88
Applicable Applications for anti-CENPW antibody
Western Blot (WB)
Homology
Guinea Pig: 77%; Horse: 79%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human C6orf173
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-C6orf173 Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysate)

Western Blot (WB) (WB Suggested Anti-C6orf173 Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysate)
Related Product Information for anti-CENPW antibody
This is a rabbit polyclonal antibody against C6orf173. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: C6orf173 is up-regulated in many cancer tissues. It suggests that C6orf173 may act as an oncogene.
Product Categories/Family for anti-CENPW antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10kDa
NCBI Official Full Name
centromere protein W isoform b
NCBI Official Synonym Full Names
centromere protein W
NCBI Official Symbol
CENPW
NCBI Official Synonym Symbols
CUG2; CENP-W; C6orf173
NCBI Protein Information
centromere protein W
UniProt Protein Name
Centromere protein W
Protein Family
UniProt Gene Name
CENPW
UniProt Synonym Gene Names
C6orf173; CUG2; CENP-W
UniProt Entry Name
CENPW_HUMAN

Uniprot Description

CENPW: Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation. The CENPA-NAC complex recruits the CENPA-CAD (nucleosome distal) complex and may be involved in incorporation of newly synthesized CENPA into centromeres. Part of a nucleosome-associated complex that binds specifically to histone H3-containing nucleosomes at the centromere, as opposed to nucleosomes containing CENPA. Component of the heterotetrameric CENP-T-W-S-X complex that binds and supercoils DNA, and plays an important role in kinetochore assembly. CENPW has a fundamental role in kinetochore assembly and function. It is one of the inner kinetochore proteins, with most further proteins binding downstream. Required for normal chromosome organization and normal progress through mitosis. Belongs to the CENPW family.

Protein type: Nucleolus

Chromosomal Location of Human Ortholog: 6q22.32

Cellular Component: kinetochore; nucleoplasm; nuclear matrix; nucleolus; chromosome, pericentric region

Molecular Function: protein binding; DNA binding; protein heterodimerization activity

Biological Process: nucleosome assembly; mitosis; kinetochore assembly; DNA replication-independent nucleosome assembly at centromere; cell division; mitotic cell cycle; chromosome organization and biogenesis; chromosome segregation

Research Articles on CENPW

Similar Products

Product Notes

The CENPW cenpw (Catalog #AAA3211657) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C6orf173 antibody - N-terminal region reacts with Guinea Pig, Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's C6orf173 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CENPW cenpw for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ALSTIVSQRK QIKRKAPRGF LKRVFKRKKP QLRLEKSGDL LVHLNCLLFV. It is sometimes possible for the material contained within the vial of "C6orf173, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.