Rabbit anti-Human, Mouse C4BPA Polyclonal Antibody | anti-C4BPA antibody

C4BPA (C4b-binding Protein alpha Chain, C4bp, Proline-rich Protein, PRP, C4BP) (FITC)

Cat. Num. AAA6371698

• Gene Names: C4BPA; PRP; C4BP
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: C4BPA; Polyclonal Antibody; C4BPA (C4b-binding Protein alpha Chain; C4bp; Proline-rich Protein; PRP; C4BP) (FITC); anti-C4BPA antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human C4BPA. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).

• Applicable Applications for anti-C4BPA antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human C4BPA, aa1-597 (NP_000706.1).
• Immunogen Sequence: MHPPKTPSGALHRKRKMAAWPFSRLWKVSDPILFQMTLIAALLPAVLGNCGPPPTLSFAAPMDITLTETRFKTGTTLKYTCLPGYVRSHSTQTLTCNSDGEWVYNTFCIYKRCRHPGELRNGQVEIKTDLSFGSQIEFSCSEGFFLIGSTTSRCEVQDRGVGWSHPLPQCEIVKCKPPPDIRNGRHSGEENFYAYGFSVTYSCDPRFSLLGHASISCTVENETIGVWRPSPPTCEKITCRKPDVSHGEMVSGFGPIYNYKDTIVFKCQKGFVLRGSSVIHCDADSKWNPSPPACEPNSCINLPDIPHASWETYPRPTKEDVYVVGTVLRYRCHPGYKPTTDEPTTVICQKNLRWTPYQGCEALCCPEPKLNNGEITQHRKSRPANHCVYFYGDEISFSCHETSRFSAICQGDGTWSPRTPSCGDICNFPPKIAHGHYKQSSSYSFFKEEIIYECDKGYILVGQAKLSCSYSHWSAPAPQCKALCRKPELVNGRLSVDKDQYVEPENVTIQCDSGYGVVGPQSITCSGNRTWYPEVPKCEWETPEGCEQVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL
• Conjugate: FITC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(C4BPA rabbit polyclonal antibody. Western Blot analysis of C4BPA expression in mouse kidney.)

Western Blot (WB)

(Western Blot analysis of C4BPA expression in transfected 293T cell line by C4BPA polyclonal antibody. Lane 1: C4BPA transfected lysate (67kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-C4BPA antibody

Controls the classical pathway of complement activation. It binds as a cofactor to C3b/C4b inactivator (C3bINA), which then hydrolyzes the complement fragment C4b. It also accelerates the degradation of the C4bC2a complex (C3 convertase) by dissociating the complement fragment C2a. Alpha chain binds C4b. It interacts also with anticoagulant protein S and with serum amyloid P component.

Product Categories/Family for anti-C4BPA antibody

Antibodies; Complement

NCBI and Uniprot Product Information

• NCBI GI #: 4502503
• NCBI GeneID: 722
• NCBI Accession #: NP_000706.1
• NCBI GenBank Nucleotide #: NM_000715.3
• UniProt Accession #: P04003
• Molecular Weight: 67,033 Da
• NCBI Official Full Name: C4b-binding protein alpha chain
• NCBI Official Synonym Full Names: complement component 4 binding protein, alpha
• NCBI Official Symbol: C4BPA
• NCBI Official Synonym Symbols: PRP; C4BP
• NCBI Protein Information: C4b-binding protein alpha chain; proline-rich protein
• UniProt Protein Name: C4b-binding protein alpha chain
• Protein Family: C4b-binding protein
• UniProt Gene Name: C4BPA
• UniProt Synonym Gene Names: C4BP; C4bp; PRP
• UniProt Entry Name: C4BPA_HUMAN

NCBI Description

This gene encodes a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. Along with a single, unique beta-chain, seven identical alpha-chains encoded by this gene assemble into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster. Two pseudogenes of this gene are also found in the cluster. [provided by RefSeq, Jul 2008]

Uniprot Description

C4BPA: Controls the classical pathway of complement activation. It binds as a cofactor to C3b/C4b inactivator (C3bINA), which then hydrolyzes the complement fragment C4b. It also accelerates the degradation of the C4bC2a complex (C3 convertase) by dissociating the complement fragment C2a. Alpha chain binds C4b. It interacts also with anticoagulant protein S and with serum amyloid P component.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 1q32

Cellular Component: extracellular space; extracellular region; plasma membrane

Molecular Function: protein binding

Biological Process: negative regulation of complement activation, classical pathway; regulation of complement activation; positive regulation of protein catabolic process; innate immune response; complement activation, classical pathway