Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (C4BPA rabbit polyclonal antibody. Western Blot analysis of C4BPA expression in mouse kidney.)

Rabbit anti-Human, Mouse C4BPA Polyclonal Antibody | anti-C4BPA antibody

C4BPA (C4b-binding Protein alpha Chain, C4bp, Proline-rich Protein, PRP, C4BP) (AP)

Gene Names
C4BPA; PRP; C4BP
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
C4BPA; Polyclonal Antibody; C4BPA (C4b-binding Protein alpha Chain; C4bp; Proline-rich Protein; PRP; C4BP) (AP); anti-C4BPA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human C4BPA. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-C4BPA antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human C4BPA, aa1-597 (NP_000706.1).
Immunogen Sequence
MHPPKTPSGALHRKRKMAAWPFSRLWKVSDPILFQMTLIAALLPAVLGNCGPPPTLSFAAPMDITLTETRFKTGTTLKYTCLPGYVRSHSTQTLTCNSDGEWVYNTFCIYKRCRHPGELRNGQVEIKTDLSFGSQIEFSCSEGFFLIGSTTSRCEVQDRGVGWSHPLPQCEIVKCKPPPDIRNGRHSGEENFYAYGFSVTYSCDPRFSLLGHASISCTVENETIGVWRPSPPTCEKITCRKPDVSHGEMVSGFGPIYNYKDTIVFKCQKGFVLRGSSVIHCDADSKWNPSPPACEPNSCINLPDIPHASWETYPRPTKEDVYVVGTVLRYRCHPGYKPTTDEPTTVICQKNLRWTPYQGCEALCCPEPKLNNGEITQHRKSRPANHCVYFYGDEISFSCHETSRFSAICQGDGTWSPRTPSCGDICNFPPKIAHGHYKQSSSYSFFKEEIIYECDKGYILVGQAKLSCSYSHWSAPAPQCKALCRKPELVNGRLSVDKDQYVEPENVTIQCDSGYGVVGPQSITCSGNRTWYPEVPKCEWETPEGCEQVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(C4BPA rabbit polyclonal antibody. Western Blot analysis of C4BPA expression in mouse kidney.)

Western Blot (WB) (C4BPA rabbit polyclonal antibody. Western Blot analysis of C4BPA expression in mouse kidney.)

Western Blot (WB)

(Western Blot analysis of C4BPA expression in transfected 293T cell line by C4BPA polyclonal antibody. Lane 1: C4BPA transfected lysate (67kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of C4BPA expression in transfected 293T cell line by C4BPA polyclonal antibody. Lane 1: C4BPA transfected lysate (67kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-C4BPA antibody
Controls the classical pathway of complement activation. It binds as a cofactor to C3b/C4b inactivator (C3bINA), which then hydrolyzes the complement fragment C4b. It also accelerates the degradation of the C4bC2a complex (C3 convertase) by dissociating the complement fragment C2a. Alpha chain binds C4b. It interacts also with anticoagulant protein S and with serum amyloid P component.
Product Categories/Family for anti-C4BPA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
722
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67,033 Da
NCBI Official Full Name
C4b-binding protein alpha chain
NCBI Official Synonym Full Names
complement component 4 binding protein, alpha
NCBI Official Symbol
C4BPA
NCBI Official Synonym Symbols
PRP; C4BP
NCBI Protein Information
C4b-binding protein alpha chain; proline-rich protein
UniProt Protein Name
C4b-binding protein alpha chain
Protein Family
UniProt Gene Name
C4BPA
UniProt Synonym Gene Names
C4BP; C4bp; PRP
UniProt Entry Name
C4BPA_HUMAN

NCBI Description

This gene encodes a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. Along with a single, unique beta-chain, seven identical alpha-chains encoded by this gene assemble into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster. Two pseudogenes of this gene are also found in the cluster. [provided by RefSeq, Jul 2008]

Uniprot Description

C4BPA: Controls the classical pathway of complement activation. It binds as a cofactor to C3b/C4b inactivator (C3bINA), which then hydrolyzes the complement fragment C4b. It also accelerates the degradation of the C4bC2a complex (C3 convertase) by dissociating the complement fragment C2a. Alpha chain binds C4b. It interacts also with anticoagulant protein S and with serum amyloid P component.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 1q32

Cellular Component: extracellular space; extracellular region; plasma membrane

Molecular Function: protein binding

Biological Process: negative regulation of complement activation, classical pathway; regulation of complement activation; positive regulation of protein catabolic process; innate immune response; complement activation, classical pathway

Research Articles on C4BPA

Similar Products

Product Notes

The C4BPA c4bpa (Catalog #AAA6371695) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C4BPA (C4b-binding Protein alpha Chain, C4bp, Proline-rich Protein, PRP, C4BP) (AP) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's C4BPA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the C4BPA c4bpa for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C4BPA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.