Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: C3ARSample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human C3AR1 Polyclonal Antibody | anti-C3AR1 antibody

C3AR1 Antibody - N-terminal region

Gene Names
C3AR1; AZ3B; C3AR; HNFAG09
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
C3AR1; Polyclonal Antibody; C3AR1 Antibody - N-terminal region; anti-C3AR1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ASFSAETNSTDLLSQPWNEPPVILSMVILSLTFLLGLPGNGLVLWVAGLK
Sequence Length
482
Applicable Applications for anti-C3AR1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human C3AR
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: C3ARSample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: C3ARSample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-C3AR1 antibody
This is a rabbit polyclonal antibody against C3AR. It was validated on Western Blot

Target Description: C3a is an anaphylatoxin released during activation of the complement system. The protein encoded by this gene is an orphan G protein-coupled receptor for C3a. Binding of C3a by the encoded receptor activates chemotaxis, granule enzyme release, superoxide anion production, and bacterial opsonization.
Product Categories/Family for anti-C3AR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
719
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
C3a anaphylatoxin chemotactic receptor
NCBI Official Synonym Full Names
complement C3a receptor 1
NCBI Official Symbol
C3AR1
NCBI Official Synonym Symbols
AZ3B; C3AR; HNFAG09
NCBI Protein Information
C3a anaphylatoxin chemotactic receptor
UniProt Protein Name
C3a anaphylatoxin chemotactic receptor
UniProt Gene Name
C3AR1
UniProt Synonym Gene Names
AZ3B; C3R1; HNFAG09; C3AR; C3a-R
UniProt Entry Name
C3AR_HUMAN

NCBI Description

C3a is an anaphylatoxin released during activation of the complement system. The protein encoded by this gene is an orphan G protein-coupled receptor for C3a. Binding of C3a by the encoded receptor activates chemotaxis, granule enzyme release, superoxide anion production, and bacterial opsonization. [provided by RefSeq, May 2016]

Uniprot Description

C3aR: Receptor for the chemotactic and inflammatory peptide anaphylatoxin C3a. This receptor stimulates chemotaxis, granule enzyme release and superoxide anion production. Belongs to the G-protein coupled receptor 1 family.

Protein type: GPCR, family 1; Receptor, GPCR; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 12p13.31

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; C3a anaphylatoxin receptor activity; complement component C3a receptor activity; phosphoinositide phospholipase C activity

Biological Process: G-protein coupled receptor protein signaling pathway; positive regulation of angiogenesis; elevation of cytosolic calcium ion concentration; blood circulation; metabolic process; complement receptor mediated signaling pathway; inflammatory response; chemotaxis

Research Articles on C3AR1

Similar Products

Product Notes

The C3AR1 c3ar1 (Catalog #AAA3220185) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C3AR1 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's C3AR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the C3AR1 c3ar1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ASFSAETNST DLLSQPWNEP PVILSMVILS LTFLLGLPGN GLVLWVAGLK. It is sometimes possible for the material contained within the vial of "C3AR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.