Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (KIF13B antibody (MBS839266) used at 1 ug/ml to detect target protein.)

Rabbit KIF13B Polyclonal Antibody | anti-KIF13B antibody

KIF13B antibody

Gene Names
KIF13B; GAKIN
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
KIF13B; Polyclonal Antibody; KIF13B antibody; Polyclonal KIF13B; Anti-KIF13B; KIFB-13; Kinesin Family Member 13B; GAKIN; KIFB 13; KIAA0639; anti-KIF13B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
KIF13B antibody was raised against the N terminal of KIF13B
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIF13B antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
1826
Applicable Applications for anti-KIF13B antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
KIF13B may be involved in reorganization of the cortical cytoskeleton. KIF13B may be functionally important for the intracellular trafficking of MAGUKs and associated protein complexes.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
KIF13B antibody was raised using the N terminal of KIF13B corresponding to a region with amino acids SGKSYTMMGTADQPGLIPRLCSGLFERTQKEENEEQSFKVEVSYMEIYNE
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(KIF13B antibody (MBS839266) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (KIF13B antibody (MBS839266) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-KIF13B antibody
Rabbit polyclonal KIF13B antibody raised against the N terminal of KIF13B
Product Categories/Family for anti-KIF13B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
203 kDa (MW of target protein)
NCBI Official Full Name
kinesin-like protein KIF13B
NCBI Official Synonym Full Names
kinesin family member 13B
NCBI Official Symbol
KIF13B
NCBI Official Synonym Symbols
GAKIN
NCBI Protein Information
kinesin-like protein KIF13B
UniProt Protein Name
Kinesin-like protein KIF13B
Protein Family
UniProt Gene Name
KIF13B
UniProt Synonym Gene Names
GAKIN; KIAA0639
UniProt Entry Name
KI13B_HUMAN

Uniprot Description

KIF13B: Involved in reorganization of the cortical cytoskeleton. Regulates axon formation by promoting the formation of extra axons. May be functionally important for the intracellular trafficking of MAGUKs and associated protein complexes. Belongs to the kinesin-like protein family.

Protein type: Motor; Microtubule-binding

Chromosomal Location of Human Ortholog: 8p12

Cellular Component: microtubule; kinesin complex; axon; cytoplasm

Molecular Function: protein binding; microtubule binding; microtubule motor activity; protein kinase binding; ATP binding

Biological Process: T cell activation; metabolic process; regulation of axonogenesis; signal transduction; microtubule-based movement; protein targeting

Research Articles on KIF13B

Similar Products

Product Notes

The KIF13B kif13b (Catalog #AAA839266) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KIF13B antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KIF13B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the KIF13B kif13b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KIF13B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.