Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (C2orf25 antibody (MBS5301606) used at 1 ug/ml to detect target protein.)

Rabbit C2orf25 Polyclonal Antibody | anti-C2orf25 antibody

C2orf25 antibody

Gene Names
MMADHC; cblD; C2orf25; CL25022
Applications
Western Blot
Purity
Affinity purified
Synonyms
C2orf25; Polyclonal Antibody; C2orf25 antibody; Polyclonal C2orf25; Anti-C2orf25; CL25022; Cobalamin Deficiency Cbld Type With Homocystinuria; Chromosome ORF 2; Chromosome ORF-2; Methylmalonic Aciduria; Chromosome 2 ORF; anti-C2orf25 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C2orf25 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
296
Applicable Applications for anti-C2orf25 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
Vitamin B12 (cobalamin) is an essential cofactor in several metabolic pathways. Intracellular conversion of cobalamin to adenosylcobalamin in mitochondria and to methylcobalamin in cytoplasm is necessary for homeostasis of methylmalonic acid and homocysteine. C2ORF25 encodes a protein involved in an early step of cobalamin metabolism.
Cross-Reactivity
Human
Immunogen
C2orf25 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSSGSDESHVAAAPPDICSRTVWPDETMGPFGPQDQRFQLPGNIGFDCHL
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(C2orf25 antibody (MBS5301606) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (C2orf25 antibody (MBS5301606) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-C2orf25 antibody
Rabbit polyclonal C2orf25 antibody
Product Categories/Family for anti-C2orf25 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
33 kDa (MW of target protein)
NCBI Official Full Name
chromosome 2 open reading frame 25, isoform CRA_a
NCBI Official Synonym Full Names
methylmalonic aciduria (cobalamin deficiency) cblD type, with homocystinuria
NCBI Official Symbol
MMADHC
NCBI Official Synonym Symbols
cblD; C2orf25; CL25022
NCBI Protein Information
methylmalonic aciduria and homocystinuria type D protein, mitochondrial
UniProt Protein Name
Methylmalonic aciduria and homocystinuria type D protein, mitochondrial
UniProt Gene Name
MMADHC
UniProt Synonym Gene Names
C2orf25; CL25022
UniProt Entry Name
MMAD_HUMAN

NCBI Description

This gene encodes a mitochondrial protein that is involved in an early step of vitamin B12 metabolism. Vitamin B12 (cobalamin) is essential for normal development and survival in humans. Mutations in this gene cause methylmalonic aciduria and homocystinuria type cblD (MMADHC), a disorder of cobalamin metabolism that is characterized by decreased levels of the coenzymes adenosylcobalamin and methylcobalamin. Pseudogenes have been identified on chromosomes 11 and X.[provided by RefSeq, Nov 2008]

Uniprot Description

MMADHC: Involved in cobalamin metabolism. Defects in MMADHC are the cause of methylmalonic aciduria and homocystinuria type cblD (MMAHCD). A disorder of cobalamin metabolism characterized by decreased levels of the coenzymes adenosylcobalamin (AdoCbl) and methylcobalamin (MeCbl). Clinical features include developmental delay, hyotonia, mental retardation, seizures, megaloblastic anemia. Some patients manifest combined methylmalonic aciduria and homocystinuria (referred to as cblD original), some have only isolated homocystinuria (cblD variant 1), and others have only methylmalonic aciduria (cblD variant 2).

Chromosomal Location of Human Ortholog: 2q23.2

Cellular Component: mitochondrion; cytosol

Biological Process: vitamin metabolic process; cobalamin metabolic process; water-soluble vitamin metabolic process

Disease: Methylmalonic Aciduria And Homocystinuria, Cbld Type

Research Articles on C2orf25

Similar Products

Product Notes

The C2orf25 mmadhc (Catalog #AAA5301606) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's C2orf25 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the C2orf25 mmadhc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C2orf25, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.