Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using C1R antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Rabbit C1R Polyclonal Antibody | anti-C1R antibody
C1R Rabbit pAb
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
C1R; Polyclonal Antibody; C1R Rabbit pAb; EDSPD1; anti-C1R antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
GGQKAKMGNFPWQVFTNIHGRGGGALLGDRWILTAAHTLYPKEHEAQSNASLDVFLGHTNVEELMKLGNHPIRRVSVHPDYRQDESYNFEGDIALLELENSVTLGPNLLPICLPDNDTFYDLGLMGYVSGFGVMEEKIAHDLRFVRLPVANPQACENWLRGKNRMDVFSQNMFCAGHPSLKQDACQGDSGGVFAVRDPNTDRWVATGIVSWGIGCSRGYGFYTKVLNYVDWIKKEMEEED
Applicable Applications for anti-C1R antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 466-705 of human C1R (NP_001724.3).
Positive Samples
HT-29, Mouse liver, Rat lung
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using C1R antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using C1R antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Product Categories/Family for anti-C1R antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
80,119 Da
NCBI Official Full Name
complement C1r subcomponent
NCBI Official Synonym Full Names
complement component 1, r subcomponent
NCBI Official Symbol
C1R
NCBI Protein Information
complement C1r subcomponent
UniProt Protein Name
Complement C1r subcomponent
Protein Family
UniProt Gene Name
C1R
UniProt Entry Name
C1R_HUMAN
Uniprot Description
C1R: C1r B chain is a serine protease that combines with C1q and C1s to form C1, the first component of the classical pathway of the complement system. Belongs to the peptidase S1 family.
Protein type: EC 3.4.21.41; Protease
Chromosomal Location of Human Ortholog: 12p13
Cellular Component: extracellular region
Molecular Function: protein binding; serine-type peptidase activity; serine-type endopeptidase activity; calcium ion binding
Biological Process: innate immune response; immune response; proteolysis; complement activation, classical pathway; complement activation
Disease: Complement Component C1r/c1s Deficiency
Research Articles on C1R
Similar Products
Product Notes
The C1R c1r (Catalog #AAA9142080) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C1R Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's C1R can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the C1R c1r for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GGQKAKMGNF PWQVFTNIHG RGGGALLGDR WILTAAHTLY PKEHEAQSNA SLDVFLGHTN VEELMKLGNH PIRRVSVHPD YRQDESYNFE GDIALLELEN SVTLGPNLLP ICLPDNDTFY DLGLMGYVSG FGVMEEKIAH DLRFVRLPVA NPQACENWLR GKNRMDVFSQ NMFCAGHPSL KQDACQGDSG GVFAVRDPNT DRWVATGIVS WGIGCSRGYG FYTKVLNYVD WIKKEMEEED. It is sometimes possible for the material contained within the vial of "C1R, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
