Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-C1QBP antibody Titration: 1 ug/mLSample Type: Human Stomach Tumor)

Rabbit C1QBP Polyclonal Antibody | anti-C1QBP antibody

C1QBP Antibody - C-terminal region

Gene Names
C1QBP; p32; HABP1; gC1qR; GC1QBP; SF2p32; gC1Q-R; COXPD33; SF2AP32
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
C1QBP; Polyclonal Antibody; C1QBP Antibody - C-terminal region; anti-C1QBP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESE
Sequence Length
282
Applicable Applications for anti-C1QBP antibody
Western Blot (WB)
Homology
Cow: 83%; Dog: 86%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human C1QBP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-C1QBP antibody Titration: 1 ug/mLSample Type: Human Stomach Tumor)

Western Blot (WB) (WB Suggested Anti-C1QBP antibody Titration: 1 ug/mLSample Type: Human Stomach Tumor)
Related Product Information for anti-C1QBP antibody
This is a rabbit polyclonal antibody against C1QBP. It was validated on Western Blot

Target Description: The human complement subcomponent C1q associates with C1r and C1s in order to yield the first component of the serum complement system. The protein encoded by this gene is known to bind to the globular heads of C1q molecules and inhibit C1 activation. This protein has also been identified as the p32 subunit of pre-mRNA splicing factor SF2, as well as a hyaluronic acid-binding protein.
Product Categories/Family for anti-C1QBP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
708
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31 kDa
NCBI Official Full Name
complement component 1 Q subcomponent-binding protein, mitochondrial
NCBI Official Synonym Full Names
complement C1q binding protein
NCBI Official Symbol
C1QBP
NCBI Official Synonym Symbols
p32; HABP1; gC1qR; GC1QBP; SF2p32; gC1Q-R; COXPD33; SF2AP32
NCBI Protein Information
complement component 1 Q subcomponent-binding protein, mitochondrial
UniProt Protein Name
Complement component 1 Q subcomponent-binding protein, mitochondrial
UniProt Gene Name
C1QBP
UniProt Synonym Gene Names
GC1QBP; HABP1; SF2P32; C1qBP
UniProt Entry Name
C1QBP_HUMAN

NCBI Description

The human complement subcomponent C1q associates with C1r and C1s in order to yield the first component of the serum complement system. The protein encoded by this gene is known to bind to the globular heads of C1q molecules and inhibit C1 activation. This protein has also been identified as the p32 subunit of pre-mRNA splicing factor SF2, as well as a hyaluronic acid-binding protein. [provided by RefSeq, Jul 2008]

Uniprot Description

C1QBP: a multifunctional and multicompartmental protein involved in inflammation and infection processes, ribosome biogenesis, regulation of apoptosis, transcriptional regulation and pre-mRNA splicing. Originally identified via its binding interactions with Splicing Factor (SF-2). Multiple, diverse binding partners of C1QBP were subsequently identified, including the globular heads of complement component C1q, hyaluronic acid, selected protein kinases, the tumor suppressor ARF, and multiple antigens of bacterial and viral origin. Overexpressed in a number of cancer cell types, and has been implicated in the Warburg effect, whereby cancer cells shift their metabolism from oxidative phosphorylation to glycolysis. Inhibits the Mitochondrial Permeability Transition (MPT) pore, possibly serving a protective function against damage from oxidative stress. Binding to C1q inhibits C1. In complex with cytokeratin-1/KRT1 is a high affinty receptor for kininogen-1/HMWK. The secreted form may enhance both extrinsic and intrinsic coagulation pathways. The cell surface form may require docking with transmembrane proteins for downstream signaling which might be specific for a cell-type or response. Belongs to the MAM33 family.

Protein type: Motility/polarity/chemotaxis; Receptor, misc.; Nucleolus; Mitochondrial

Chromosomal Location of Human Ortholog: 17p13.3

Cellular Component: extracellular space; cell surface; mitochondrion; membrane; mitochondrial matrix; cytoplasm; plasma membrane; nucleolus; cytosol; nucleus

Molecular Function: mRNA binding; protein binding; adrenergic receptor binding; protein kinase C binding; complement component C1q binding; hyaluronic acid binding; kininogen binding; transcription factor binding; transcription corepressor activity

Biological Process: negative regulation of interleukin-12 production; phosphoinositide 3-kinase cascade; positive regulation of cell adhesion; viral reproduction; transcription, DNA-dependent; apoptosis; positive regulation of apoptosis; RNA splicing; negative regulation of defense response to virus; negative regulation of transcription from RNA polymerase II promoter; positive regulation of protein kinase B signaling cascade; negative regulation of nuclear mRNA splicing, via spliceosome; negative regulation of interferon-gamma production; regulation of complement activation; innate immune response; immune response; blood coagulation; mRNA processing; blood coagulation, intrinsic pathway; complement activation, classical pathway; mature ribosome assembly

Research Articles on C1QBP

Similar Products

Product Notes

The C1QBP c1qbp (Catalog #AAA3214641) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C1QBP Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's C1QBP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the C1QBP c1qbp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VVEVIKNDDG KKALVLDCHY PEDEVGQEDE AESDIFSIRE VSFQSTGESE. It is sometimes possible for the material contained within the vial of "C1QBP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.