Immunohistochemistry (IHC)
(Human kidney )
Rabbit C19ORF6 Polyclonal Antibody | anti-TMEM259 antibody
C19ORF6 antibody - middle region
Gene Names
TMEM259; MBRL; ASBABP1; C19orf6; R32184_3; MEMBRALIN
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
C19ORF6; Polyclonal Antibody; C19ORF6 antibody - middle region; anti-TMEM259 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YDDILMSSVKGLAENEENKGFLRNVVSGEHYRFVSMWMARTSYLAAFAIM
Sequence Length
408
Applicable Applications for anti-TMEM259 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human C19ORF6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Human kidney )
Immunohistochemistry (IHC)
(Human kidney )
Western Blot (WB)
(WB Suggested Anti-C19ORF6 Antibody Titration: 1.0ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateTMEM259 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)
Western Blot (WB)
(WB Suggested Anti-C19ORF6 Antibody Titration: 1.0ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateTMEM259 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)
Related Product Information for anti-TMEM259 antibody
This is a rabbit polyclonal antibody against C19ORF6. It was validated on Western Blot and immunohistochemistry
Target Description: Human membralin is unique and does not share significant sequence homology with other human genes, only membralins of other species. The membralin gene contains 11 exons which encode at least two spliced variants in human cancer. The long form of membralin (membralin-1) comprises all 11 exons, encoding a protein of 620-amino acids long and the short form of membralin (membralin-3) contains all exons except for exon 10, encoding a protein of 408 amino acids. Expression of different membralin isoforms depends on tissue type. The long form, membralin-1, is expressed in ovarian and colorectal carcinomas but not in breast or pancreatic carcinomas, which express only the short splice form, membralin-3. Recent studies suggest that membralin is a novel tumor-associated marker in ovarian serous carcinomas
Target Description: Human membralin is unique and does not share significant sequence homology with other human genes, only membralins of other species. The membralin gene contains 11 exons which encode at least two spliced variants in human cancer. The long form of membralin (membralin-1) comprises all 11 exons, encoding a protein of 620-amino acids long and the short form of membralin (membralin-3) contains all exons except for exon 10, encoding a protein of 408 amino acids. Expression of different membralin isoforms depends on tissue type. The long form, membralin-1, is expressed in ovarian and colorectal carcinomas but not in breast or pancreatic carcinomas, which express only the short splice form, membralin-3. Recent studies suggest that membralin is a novel tumor-associated marker in ovarian serous carcinomas
Product Categories/Family for anti-TMEM259 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
membralin isoform 2
NCBI Official Synonym Full Names
transmembrane protein 259
NCBI Official Symbol
TMEM259
NCBI Official Synonym Symbols
MBRL; ASBABP1; C19orf6; R32184_3; MEMBRALIN
NCBI Protein Information
membralin
UniProt Protein Name
Membralin
Protein Family
UniProt Gene Name
C19orf6
UniProt Entry Name
MBRL_HUMAN
Research Articles on TMEM259
Similar Products
Product Notes
The TMEM259 c19orf6 (Catalog #AAA3201881) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C19ORF6 antibody - middle region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's C19ORF6 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the TMEM259 c19orf6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YDDILMSSVK GLAENEENKG FLRNVVSGEH YRFVSMWMAR TSYLAAFAIM. It is sometimes possible for the material contained within the vial of "C19ORF6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
