Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-C14ORF156 antibodyParaffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Rabbit C14ORF156 Polyclonal Antibody | anti-SLIRP antibody

C14ORF156 antibody - N-terminal region

Gene Names
SLIRP; DC50; PD04872; C14orf156
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
C14ORF156; Polyclonal Antibody; C14ORF156 antibody - N-terminal region; anti-SLIRP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PFDKETGFHRGLGWVQFSSEEGLRNALQQENHIIDGVKVQVHTRRPKLPQ
Sequence Length
109
Applicable Applications for anti-SLIRP antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 79%; Horse: 86%; Human: 100%; Pig: 79%; Rabbit: 86%; Sheep: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human C14ORF156
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-C14ORF156 antibodyParaffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC) (Rabbit Anti-C14ORF156 antibodyParaffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Western Blot (WB)

(Host: RabbitTarget Name: SLIRPSample Tissue: Human HCT15 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SLIRPSample Tissue: Human HCT15 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-C14ORF156 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateSLIRP is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (WB Suggested Anti-C14ORF156 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateSLIRP is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-SLIRP antibody
This is a rabbit polyclonal antibody against C14ORF156. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: As a RNA-binding protein, C14orf156 acts as a nuclear receptor corepressor. It probably acts by binding the SRA RNA, and repressing the SRA-mediated nuclear receptor coactivation. C14orf156 binds the STR7 loop of SRA RNA. It is also able to repress glucocorticoid (GR), androgen (AR), thyroid (TR) and VDR-mediated transactivation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12kDa
NCBI Official Full Name
SRA stem-loop-interacting RNA-binding protein, mitochondrial isoform 1
NCBI Official Synonym Full Names
SRA stem-loop interacting RNA binding protein
NCBI Official Symbol
SLIRP
NCBI Official Synonym Symbols
DC50; PD04872; C14orf156
NCBI Protein Information
SRA stem-loop-interacting RNA-binding protein, mitochondrial
UniProt Protein Name
SRA stem-loop-interacting RNA-binding protein, mitochondrial
UniProt Gene Name
SLIRP
UniProt Synonym Gene Names
C14orf156
UniProt Entry Name
SLIRP_HUMAN

NCBI Description

Steroid receptor RNA activator (SRA, or SRA1; MIM 603819) is a complex RNA molecule containing multiple stable stem-loop structures that functions in coactivation of nuclear receptors. SLIRP interacts with stem-loop structure-7 of SRA (STR7) and modulates nuclear receptor transactivation (Hatchell et al., 2006 [PubMed 16762838]).[supplied by OMIM, Mar 2008]

Uniprot Description

SLIRP: RNA-binding protein that acts as a nuclear receptor corepressor. Probably acts by binding the SRA RNA, and repressing the SRA-mediated nuclear receptor coactivation. Binds the STR7 loop of SRA RNA. Also able to repress glucocorticoid (GR), androgen (AR), thyroid (TR) and VDR-mediated transactivation.

Protein type: RNA-binding; Nuclear receptor co-regulator; Mitochondrial; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 14q24.3

Cellular Component: mitochondrion; perinuclear region of cytoplasm; acrosome; nucleus; ribonucleoprotein complex

Molecular Function: nucleotide binding

Biological Process: sperm motility; transcription, DNA-dependent; regulation of transcription, DNA-dependent; single fertilization; spermatid development

Research Articles on SLIRP

Similar Products

Product Notes

The SLIRP slirp (Catalog #AAA3205607) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C14ORF156 antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Pig, Rabbit, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's C14ORF156 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLIRP slirp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PFDKETGFHR GLGWVQFSSE EGLRNALQQE NHIIDGVKVQ VHTRRPKLPQ. It is sometimes possible for the material contained within the vial of "C14ORF156, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.