Mouse anti-Human GUCY2C Monoclonal Antibody | anti-GUCY2C antibody

GUCY2C (Guanylyl Cyclase C, Guanylate Cyclase 2C (Heat Stable Enterotoxin Receptor), GUC2C, STAR) (HRP)

Cat. Num. AAA6156033

• Gene Names: GUCY2C; GC-C; STAR; DIAR6; GUC2C; MECIL; MUCIL
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified
• Synonyms: GUCY2C; Monoclonal Antibody; GUCY2C (Guanylyl Cyclase C; Guanylate Cyclase 2C (Heat Stable Enterotoxin Receptor); GUC2C; STAR) (HRP); anti-GUCY2C antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2G7
• Specificity: Recognizes human GUCY2C.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 1073

• Applicable Applications for anti-GUCY2C antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa24-133 from human GUCY2C with GST tag (NP_004954). MW of the GST tag alone is 26kD.
• Immunogen Sequence: SQVSQNCHNGSYEISVLMMGNSAFAEPLKNLEDAVNEGLEIVRGRLQNAGLNVTVNATFMYSDGLIHNSGDCRSSTCEGLDLLRKISNAQRMGCVLIGPSCTYSTFQMYL
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against immunogen (37.73kD))

Western Blot (WB)

(Western Blot analysis of GUCY2C expression in U-2 OS using 207688.)

Testing Data

(Detection limit for 207688 is ~0.3ng/ml as a capture antibody.)

Related Product Information for anti-GUCY2C antibody

Receptor for the E.coli heat-stable enterotoxin (E.coli enterotoxin markedly stimulates the accumulation of cGMP in mammalian cells expressing GC-C). Also activated by the endogenous peptides guanylin and uroguanylin.

Product Categories/Family for anti-GUCY2C antibody

Antibodies; Enzymes

NCBI and Uniprot Product Information

• NCBI GI #: 222080083
• NCBI GeneID: 2984
• NCBI Accession #: NP_004954
• NCBI GenBank Nucleotide #: NP_004954.2
• UniProt Accession #: P25092
• NCBI Official Full Name: heat-stable enterotoxin receptor
• NCBI Official Synonym Full Names: guanylate cyclase 2C
• NCBI Official Symbol: GUCY2C
• NCBI Official Synonym Symbols: GC-C; STAR; DIAR6; GUC2C; MECIL; MUCIL
• NCBI Protein Information: heat-stable enterotoxin receptor
• UniProt Protein Name: Heat-stable enterotoxin receptor
• Protein Family: Heat-stable enterotoxin receptor
• UniProt Gene Name: GUCY2C
• UniProt Synonym Gene Names: GUC2C; STAR; STA receptor; hSTAR; GC-C

NCBI Description

This gene encodes a transmembrane protein that functions as a receptor for endogenous peptides guanylin and uroguanylin, and the heat-stable E. coli enterotoxin. The encoded protein activates the cystic fibrosis transmembrane conductance regulator. Mutations in this gene are associated with familial diarrhea (autosomal dominant) and meconium ileus (autosomal recessive). [provided by RefSeq, Nov 2016]

Uniprot Description

Receptor for the E.coli heat-stable enterotoxin (E.coli enterotoxin markedly stimulates the accumulation of cGMP in mammalian cells expressing GC-C). Also activated by the endogenous peptides guanylin and uroguanylin.