Western Blot (WB)
(WB Suggested Anti-C10orf38 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysateFAM171A1 is supported by BioGPS gene expression data to be expressed in HEK293T)
Rabbit C10orf38 Polyclonal Antibody | anti-FAM171A1 antibody
C10orf38 antibody - middle region
Gene Names
FAM171A1; APCN; C10orf38
Reactivity
Guinea Pig, Human, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
C10orf38; Polyclonal Antibody; C10orf38 antibody - middle region; anti-FAM171A1 antibody
Host
Rabbit
Reactivity
Guinea Pig, Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ARKSMEREGYESSGNDDYRGSYNTVLSQPLFEKQDREGPASTGSKLTIQE
Sequence Length
890
Applicable Applications for anti-FAM171A1 antibody
Western Blot (WB)
Homology
Guinea Pig: 93%; Human: 100%; Rabbit: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human C10orf38
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-C10orf38 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysateFAM171A1 is supported by BioGPS gene expression data to be expressed in HEK293T)
Western Blot (WB)
(WB Suggested Anti-C10orf38 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysateFAM171A1 is supported by BioGPS gene expression data to be expressed in HEK293T)
Related Product Information for anti-FAM171A1 antibody
This is a rabbit polyclonal antibody against C10orf38. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The exact function of C10orf38 remains unknown.
Target Description: The exact function of C10orf38 remains unknown.
Product Categories/Family for anti-FAM171A1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
98kDa
NCBI Official Full Name
protein FAM171A1
NCBI Official Synonym Full Names
family with sequence similarity 171 member A1
NCBI Official Symbol
FAM171A1
NCBI Official Synonym Symbols
APCN; C10orf38
NCBI Protein Information
protein FAM171A1
UniProt Protein Name
Protein FAM171A1
Protein Family
UniProt Gene Name
FAM171A1
UniProt Synonym Gene Names
C10orf38
UniProt Entry Name
F1711_HUMAN
Research Articles on FAM171A1
Similar Products
Product Notes
The FAM171A1 fam171a1 (Catalog #AAA3207453) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C10orf38 antibody - middle region reacts with Guinea Pig, Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's C10orf38 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FAM171A1 fam171a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ARKSMEREGY ESSGNDDYRG SYNTVLSQPL FEKQDREGPA STGSKLTIQE. It is sometimes possible for the material contained within the vial of "C10orf38, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
