Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

C Reactive Protein (CRP) Recombinant Protein | CRP recombinant protein

Recombinant C Reactive Protein (CRP)

Gene Names
Crp; Aa1249; Ac1262; Ab1-341; Ab2-196; Ac1-114; Ac2-069; Ba2-693
Applications
SDS-Page, Western Blot, ELISA, Immunoprecipitation
Purity
> 95%
Synonyms
C Reactive Protein (CRP); Recombinant C Reactive Protein (CRP); CRP recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
> 95%
Form/Format
Supplied as lyophilized form in PBS,pH7.4, containing 5% sucrose, 0.01% sarcosyl.
Sequence
The target protein is fused with two N-terminal tags, his-tag and T7 tag, its sequence is listed below.
MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-H EDMSKQAFVF PGVSATAYVS LEAESKKPLE AFTVCLYAHA DVSRSFSIFS YATKTSFNEI LLFWTRGQGF SIAVGGPEIL FSASEIPEVP THICATWESA TGIVELWLDG KPRVRKSLQK GYIVGTNASI ILGQEQDSYG GGFDANQSLV GDIGDVNMWD FVLSPEQINA VYVGRVFSPN VLNWRALKYE THGDVFIKPQ LWPLTDCCES
Sequence Length
230
Applicable Applications for CRP recombinant protein
SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP)
Organism
Rattus norvegicus (Rat)
Expression System
Prokaryotic expression
Residues
His20~Ser230 (Accession # P48199) with two N-terminal tags, his-tag and T7 tag
Endotoxin Level
<1.0EU per 1ug (determined by the LAL method)
Reconstitution
Reconstitute in sterile PBS, pH7.2-pH7.4.
Preparation and Storage
Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months.
Stability Test: The thermal stability is described by the loss rate of the targetprotein. The loss rate was determined by accelerated thermal degradation test,that is, incubate the protein at 37 degree C for 48h, and no obvious degradation andprecipitation were observed. (Referring from China Biological Products Standard,which was calculated by the Arrhenius equation.) The loss of this protein is lessthan 5% within the expiration date under appropriate storage condition.

SDS-Page

SDS-Page

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27.1kDa
NCBI Official Full Name
C-reactive protein
NCBI Official Synonym Full Names
C-reactive protein, pentraxin-related
NCBI Official Symbol
Crp
NCBI Official Synonym Symbols
Aa1249; Ac1262; Ab1-341; Ab2-196; Ac1-114; Ac2-069; Ba2-693
NCBI Protein Information
C-reactive protein; C-reactive protein, petaxin related; C-reactive protein member of the pentraxin family; C-reactive protein, member of the pentraxin family
UniProt Protein Name
C-reactive protein
Protein Family
UniProt Gene Name
Crp
UniProt Synonym Gene Names
Ptx1
UniProt Entry Name
CRP_RAT

NCBI Description

glycoprotein of the acute phase response [RGD, Feb 2006]

Uniprot Description

Function: Displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. Can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells

By similarity.

Cofactor: Binds 2 calcium ions per subunit

By similarity.

Subunit structure: Homopentamer. Pentaxin (or pentraxin) have a discoid arrangement of 5 non-covalently bound subunits. Two of the five chains form a dimer linked by two interchain disulfide bonds located in the C-terminal heptapeptide and specific to rat CRP.

Subcellular location: Secreted.

Tissue specificity: Found in plasma.

Post-translational modification: The last two cysteines are involved either in interchain disulfide bonds or in an intrachain bond.

Sequence similarities: Belongs to the pentaxin family.Contains 1 pentaxin domain.

Research Articles on CRP

Similar Products

Product Notes

The CRP crp (Catalog #AAA2011681) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's C Reactive Protein (CRP) can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP). Researchers should empirically determine the suitability of the CRP crp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: The target protein is fused with two N-terminal tags, his-tag and T7 tag, its sequence is listed below. MGSSHHHHHH SSGLVPRGSH MASMTGGQQM GRGSEF-H EDMSKQAFVF PGVSATAYVS LEAESKKPLE AFTVCLYAHA DVSRSFSIFS YATKTSFNEI LLFWTRGQGF SIAVGGPEIL FSASEIPEVP THICATWESA TGIVELWLDG KPRVRKSLQK GYIVGTNASI ILGQEQDSYG GGFDANQSLV GDIGDVNMWD FVLSPEQINA VYVGRVFSPN VLNWRALKYE THGDVFIKPQ LWPLTDCCES. It is sometimes possible for the material contained within the vial of "C Reactive Protein (CRP), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.