Western Blot (WB)
(WB Suggested Anti-BRF1 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: NIH/3T3 cell lysate)
Rabbit BRF1 Polyclonal Antibody | anti-BRF1 antibody
BRF1 antibody - C-terminal region
Gene Names
Brf1; GTF3B; TAF3C; TAFIII90; TFIIIB90; mTFIIIB90; 2510002F24Rik
Reactivity
Cow, Dog, Mouse, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
BRF1; Polyclonal Antibody; BRF1 antibody - C-terminal region; anti-BRF1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PALGAEPIKPSAVLVESGPVSYHPEEDADEEDAEDEDGEPCVSALQMMGG
Sequence Length
203
Applicable Applications for anti-BRF1 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 92%; Mouse: 100%; Rat: 100%;
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-BRF1 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: NIH/3T3 cell lysate)
Western Blot (WB)
(WB Suggested Anti-BRF1 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: NIH/3T3 cell lysate)
Related Product Information for anti-BRF1 antibody
This is a rabbit polyclonal antibody against BRF1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: BRF1 is one of the three subunits of the RNA polymerase III transcription factor complex. This complex plays a central role in transcription initiation by RNA polymerase III on genes encoding tRNA, 5S rRNA, and other small structural RNAs.
Target Description: BRF1 is one of the three subunits of the RNA polymerase III transcription factor complex. This complex plays a central role in transcription initiation by RNA polymerase III on genes encoding tRNA, 5S rRNA, and other small structural RNAs.
Product Categories/Family for anti-BRF1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
22kDa
NCBI Official Full Name
Brf1 protein
NCBI Official Synonym Full Names
BRF1, RNA polymerase III transcription initiation factor 90 kDa subunit
NCBI Official Symbol
Brf1
NCBI Official Synonym Symbols
GTF3B; TAF3C; TAFIII90; TFIIIB90; mTFIIIB90; 2510002F24Rik
NCBI Protein Information
transcription factor IIIB 90 kDa subunit
Protein Family
Research Articles on BRF1
Similar Products
Product Notes
The BRF1 (Catalog #AAA3203568) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BRF1 antibody - C-terminal region reacts with Cow, Dog, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's BRF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BRF1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PALGAEPIKP SAVLVESGPV SYHPEEDADE EDAEDEDGEP CVSALQMMGG. It is sometimes possible for the material contained within the vial of "BRF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
