Western Blot (WB)
(BMP2 rabbit polyclonal antibody. Western Blot analysis of BMP2 expression in human liver.)
Rabbit anti-Human Bone Morphogenetic Protein 2 Polyclonal Antibody | anti-BMP2 antibody
Bone Morphogenetic Protein 2 (BMP2, BMP-2, Bone Morphogenetic protein 2A, BMP-2A, BMP2A) (PE)
Gene Names
BMP2; BDA2; BMP2A; SSFSC
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Bone Morphogenetic Protein 2; Polyclonal Antibody; Bone Morphogenetic Protein 2 (BMP2; BMP-2; Bone Morphogenetic protein 2A; BMP-2A; BMP2A) (PE); anti-BMP2 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human BMP2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
1252
Applicable Applications for anti-BMP2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human BMP2, aa1-396 (AAI48690.1).
Immunogen Sequence
MVAGTRCLLALLLPQVLLGGAAGLVPELGRRKFAAASSGRPSSQPSDEVLSEFELRLLSMFGLKQRPTPSRDAVVPPYMLDLYRRHSGQPGSPAPDHRLERAASRANTVRSFHHEESLEELPETSGKTTRRFFFNLSSIPTEEFITSAELQVFREQMQDALGNNSSFHHRINIYEIIKPATANSKFPVTRLLDTRLVNQNASRWESFDVTPAVMRWTAQGHANHGFVVEVAHLEEKQGVSKRHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKACCVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(BMP2 rabbit polyclonal antibody. Western Blot analysis of BMP2 expression in human liver.)
Western Blot (WB)
(BMP2 rabbit polyclonal antibody. Western Blot analysis of BMP2 expression in human liver.)
Western Blot (WB)
(Western Blot analysis of BMP2 expression in transfected 293T cell line by BMP2 polyclonal antibody. Lane 1: BMP2 transfected lysate (43.56kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of BMP2 expression in transfected 293T cell line by BMP2 polyclonal antibody. Lane 1: BMP2 transfected lysate (43.56kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-BMP2 antibody
BMPs (bone morphogenetic proteins) belong to the TGF-beta superfamily of structurally related signaling proteins. Members of this superfamily are widely represented throughout the animal kingdom and have been implicated in a variety of developmental processes. Proteins of the TGF-beta superfamily are disulfide-linked dimers composed of two 12-15kD polypeptide chains. As implied by their name, BMPs initiate, promote and regulate bone development, growth, remodeling and repair. In addition to its osteogenic activity, BMP-2 plays an important role in cardiac morphogenesis. It is also expressed in a variety of tissues such as lung, spleen, brain, liver, prostate ovary and small intestine.
Product Categories/Family for anti-BMP2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Synthetic construct Homo sapiens clone IMAGE:100015698, MGC:183153 bone morphogenetic protein 2 (BMP2) mRNA, encodes complete protein
NCBI Official Synonym Full Names
bone morphogenetic protein 2
NCBI Official Symbol
BMP2
NCBI Official Synonym Symbols
BDA2; BMP2A; SSFSC
NCBI Protein Information
bone morphogenetic protein 2
Protein Family
NCBI Description
This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer, which plays a role in bone and cartilage development. Duplication of a regulatory region downstream of this gene causes a form of brachydactyly characterized by a malformed index finger and second toe in human patients. [provided by RefSeq, Jul 2016]
Research Articles on BMP2
Similar Products
Product Notes
The BMP2 (Catalog #AAA6371408) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Bone Morphogenetic Protein 2 (BMP2, BMP-2, Bone Morphogenetic protein 2A, BMP-2A, BMP2A) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Bone Morphogenetic Protein 2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BMP2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Bone Morphogenetic Protein 2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
