Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: BNIPLSample Tissue: Human Stomach Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human BNIPL Polyclonal Antibody | anti-BNIPL antibody

BNIPL Antibody - C-terminal region

Gene Names
BNIPL; BNIPS; PP753; BNIP-S; BNIPL1; BNIPL2; BNIPL-1; BNIPL-2; BNIP-Sbeta; BNIP-Salpha
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
BNIPL; Polyclonal Antibody; BNIPL Antibody - C-terminal region; anti-BNIPL antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 23% sucrose.
Sequence
Synthetic peptide located within the following region: WIRQCYRTLDRRLRKNLRALVVVHATWYVKAFLALLRPFISSKFTRKIRF
Sequence Length
275
Applicable Applications for anti-BNIPL antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human BNIPL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: BNIPLSample Tissue: Human Stomach Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: BNIPLSample Tissue: Human Stomach Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-BNIPL antibody
BCL2/adenovirus E1B 19kD interacting protein like

Target Description: The protein encoded by this gene interacts with several other proteins, such as BCL2, ARHGAP1, MIF and GFER. It may function as a bridge molecule between BCL2 and ARHGAP1/CDC42 in promoting cell death. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Product Categories/Family for anti-BNIPL antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30 kDa
NCBI Official Full Name
bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like protein isoform b
NCBI Official Synonym Full Names
BCL2 interacting protein like
NCBI Official Symbol
BNIPL
NCBI Official Synonym Symbols
BNIPS; PP753; BNIP-S; BNIPL1; BNIPL2; BNIPL-1; BNIPL-2; BNIP-Sbeta; BNIP-Salpha
NCBI Protein Information
bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like protein
UniProt Protein Name
Bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like protein
UniProt Gene Name
BNIPL
UniProt Entry Name
BNIPL_HUMAN

NCBI Description

The protein encoded by this gene interacts with several other proteins, such as BCL2, ARHGAP1, MIF and GFER. It may function as a bridge molecule between BCL2 and ARHGAP1/CDC42 in promoting cell death. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Aug 2011]

Uniprot Description

BNIPL: May be a bridge molecule between BCL2 and ARHGAP1/CDC42 in promoting cell death. 3 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 1q21.3

Cellular Component: nucleus; cytosol

Molecular Function: identical protein binding; protein binding

Biological Process: negative regulation of cell proliferation; apoptosis; regulation of growth rate

Research Articles on BNIPL

Similar Products

Product Notes

The BNIPL bnipl (Catalog #AAA3210860) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BNIPL Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BNIPL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BNIPL bnipl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WIRQCYRTLD RRLRKNLRAL VVVHATWYVK AFLALLRPFI SSKFTRKIRF. It is sometimes possible for the material contained within the vial of "BNIPL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.