Western Blot (WB)
(WB Suggested Anti-UBTFL1 Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysate)
Rabbit UBTFL1 Polyclonal Antibody | anti-UBTFL1 antibody
UBTFL1 antibody - N-terminal region
Gene Names
UBTFL1; HMGPI; C11orf27
Reactivity
Guinea Pig, Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
UBTFL1; Polyclonal Antibody; UBTFL1 antibody - N-terminal region; anti-UBTFL1 antibody
Host
Rabbit
Reactivity
Guinea Pig, Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ELVLEAKKCVKKMNKSQKYRNGPDFPKRPLTAYNRFFKESWPQYSQMYPG
Sequence Length
393
Applicable Applications for anti-UBTFL1 antibody
Western Blot (WB)
Homology
Guinea Pig: 77%; Human: 100%; Rat: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human LOC642623
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-UBTFL1 Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysate)
Western Blot (WB)
(WB Suggested Anti-UBTFL1 Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysate)
Related Product Information for anti-UBTFL1 antibody
This is a rabbit polyclonal antibody against LOC642623. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The exact function of LOC642623 remains unknown.
Target Description: The exact function of LOC642623 remains unknown.
Product Categories/Family for anti-UBTFL1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Synonym Full Names
upstream binding transcription factor like 1
NCBI Official Symbol
UBTFL1
NCBI Official Synonym Symbols
HMGPI; C11orf27
NCBI Protein Information
upstream-binding factor 1-like protein 1
UniProt Protein Name
Putative upstream-binding factor 1-like protein 1
Protein Family
UniProt Gene Name
UBTFL1
UniProt Synonym Gene Names
C11orf27
UniProt Entry Name
UBFL1_HUMAN
NCBI Description
UBTFL1 is a preimplantation-specific gene and is involved in early development, implantation, and embryonic stem (ES) cell derivation (summary by Yamada et al., 2010 [PubMed 19915186]).[supplied by OMIM, Jan 2011]
Uniprot Description
UBTFL1: Essential for proliferation of the inner cell mass and trophectodermal cells in peri-implantation development.
Protein type: Unknown function
Chromosomal Location of Human Ortholog: 11q14.3
Cellular Component: cytoplasm; nucleus
Molecular Function: DNA binding
Biological Process: regulation of gene expression; blastocyst growth; embryo implantation
Research Articles on UBTFL1
Similar Products
Product Notes
The UBTFL1 ubtfl1 (Catalog #AAA3210193) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UBTFL1 antibody - N-terminal region reacts with Guinea Pig, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's UBTFL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UBTFL1 ubtfl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ELVLEAKKCV KKMNKSQKYR NGPDFPKRPL TAYNRFFKES WPQYSQMYPG. It is sometimes possible for the material contained within the vial of "UBTFL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
