Western Blot (WB)
(WB Suggested Anti-BIRC7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: THP-1 cell lysate)
Rabbit BIRC7 Polyclonal Antibody | anti-BIRC7 antibody
BIRC7 antibody - middle region
Gene Names
BIRC7; KIAP; LIVIN; MLIAP; RNF50; ML-IAP
Reactivity
Cow, Dog, Human, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
BIRC7; Polyclonal Antibody; BIRC7 antibody - middle region; anti-BIRC7 antibody
Host
Rabbit
Reactivity
Cow, Dog, Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFL
Sequence Length
298
Applicable Applications for anti-BIRC7 antibody
Western Blot (WB)
Homology
Cow: 85%; Dog: 84%; Human: 100%; Rabbit: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human BIRC7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-BIRC7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: THP-1 cell lysate)
Western Blot (WB)
(WB Suggested Anti-BIRC7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: THP-1 cell lysate)
Related Product Information for anti-BIRC7 antibody
This is a rabbit polyclonal antibody against BIRC7. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: BIRC7 protects against apoptosis induced by TNF or by chemical agents such as adriamycin, etoposide or staurosporine. Suppression of apoptosis is mediated by activation of MAPK8/JNK1, and possibly also of MAPK9/JNK2. This activation depends on TAB1 and NR2C2/TAK1. In vitro, inhibits caspase-3 and proteolytic activation of pro-caspase-9. Isoform 1 blocks staurosporine-induced apoptosis. Isoform 2 blocks etoposide-induced apoptosis.The protein encoded by this gene is a member of the family of inhibitor of apoptosis proteins (IAP) and contains a single copy of a baculovirus IAP repeat (BIR) as well as a RING-type zinc finger domain. The BIR domain is essential for inhibitory activity and interacts with caspases, while the RING finger domain sometimes enhances antiapoptotic activity but does not inhibit apoptosis alone. Two transcript variants encoding different isoforms have been found for this gene. The two isoforms have different antiapoptotic properties, with isoform alpha protecting cells from apoptosis induced by staurosporine and isoform b protecting cells from apoptosis induced by etoposide.
Target Description: BIRC7 protects against apoptosis induced by TNF or by chemical agents such as adriamycin, etoposide or staurosporine. Suppression of apoptosis is mediated by activation of MAPK8/JNK1, and possibly also of MAPK9/JNK2. This activation depends on TAB1 and NR2C2/TAK1. In vitro, inhibits caspase-3 and proteolytic activation of pro-caspase-9. Isoform 1 blocks staurosporine-induced apoptosis. Isoform 2 blocks etoposide-induced apoptosis.The protein encoded by this gene is a member of the family of inhibitor of apoptosis proteins (IAP) and contains a single copy of a baculovirus IAP repeat (BIR) as well as a RING-type zinc finger domain. The BIR domain is essential for inhibitory activity and interacts with caspases, while the RING finger domain sometimes enhances antiapoptotic activity but does not inhibit apoptosis alone. Two transcript variants encoding different isoforms have been found for this gene. The two isoforms have different antiapoptotic properties, with isoform alpha protecting cells from apoptosis induced by staurosporine and isoform b protecting cells from apoptosis induced by etoposide.
Product Categories/Family for anti-BIRC7 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
baculoviral IAP repeat-containing protein 7 isoform alpha
NCBI Official Synonym Full Names
baculoviral IAP repeat containing 7
NCBI Official Symbol
BIRC7
NCBI Official Synonym Symbols
KIAP; LIVIN; MLIAP; RNF50; ML-IAP
NCBI Protein Information
baculoviral IAP repeat-containing protein 7
UniProt Protein Name
Baculoviral IAP repeat-containing protein 7
Protein Family
UniProt Gene Name
BIRC7
UniProt Synonym Gene Names
KIAP; LIVIN; MLIAP; RNF50; KIAP; ML-IAP; Truncated livin; p30-Livin; tLivin
UniProt Entry Name
BIRC7_HUMAN
NCBI Description
This gene encodes a member of the inhibitor of apoptosis protein (IAP) family, and contains a single copy of a baculovirus IAP repeat (BIR) as well as a RING-type zinc finger domain. The BIR domain is essential for inhibitory activity and interacts with caspases, while the RING finger domain sometimes enhances antiapoptotic activity but does not inhibit apoptosis alone. Elevated levels of the encoded protein may be associated with cancer progression and play a role in chemotherapy sensitivity. Alternative splicing results in multiple transcript variants [provided by RefSeq, Jul 2013]
Research Articles on BIRC7
Similar Products
Product Notes
The BIRC7 birc7 (Catalog #AAA3224348) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BIRC7 antibody - middle region reacts with Cow, Dog, Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's BIRC7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BIRC7 birc7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EERTCKVCLD RAVSIVFVPC GHLVCAECAP GLQLCPICRA PVRSRVRTFL. It is sometimes possible for the material contained within the vial of "BIRC7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
