Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot: Sample: Mouse Spleen lysate; Primary Ab: 3ug/ml Rabbit Anti-Mouse bTG Antibody;Second Ab: 0.2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody;)

Rabbit anti-Mouse Beta-Thromboglobulin (bTG) Polyclonal Antibody | anti-bTG antibody

Polyclonal Antibody to Beta-Thromboglobulin (bTG)

Gene Names
Ppbp; TGB; LDGF; MDGF; TGB1; CTAP3; Cxcl7; NAP-2; Scyb7; b-TG1; LA-PF4; THBGB1; CTAPIII; beta-TG; AI854500; NAP-2-L1; 2400003M24Rik
Reactivity
Mouse
Applications
Immunocytochemistry, Immunohistochemistry, ELISA, Western Blot
Purity
Affinity Chromatography
Synonyms
Beta-Thromboglobulin (bTG); Polyclonal Antibody; Polyclonal Antibody to Beta-Thromboglobulin (bTG); anti-bTG antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Specificity
The antibody is a rabbit polyclonal antibody raised against bTG. It has been selected for its ability to recognize bTG in immunohistochemical staining andwestern blotting.
Purity/Purification
Affinity Chromatography
Form/Format
Supplied as solution form in PBS, pH7.4, containing 0.02% NaN3,50% glycerol.
Concentration
500ug/mL (varies by lot)
Sequence
Antigen: The target protein is fused with two N-terminal Tags, His-tag and its sequence is listed below.
MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-K SDGMDPYIEL RCRCTNTISG IPFNSISLVN VYRPGVHCAD VEVIATLKNG QKTCLDPNAP GVKRIVMKIL EGY
Applicable Applications for anti-bTG antibody
Immunocytochemistry (ICC), Immunohistochemistry (IHC) - Formalin/Paraffin, ELISA (EIA), Western Blot (WB)
Application Notes
Western blotting: 1:100-400
Immunocytochemistry in formalin fixed cells: 1:100-500
Immunohistochemistry in formalin fixed frozen section: 1:100-500
Immunohistochemistry in paraffin section: 1:50-200
Enzyme-linked Immunosorbent Assay: 1:100-200
Immunogen
Recombinant bTG (Lys40~Tyr113) expressed in E.coli.
Cross Reactivity
Mouse
Conjugated Antibody
The APC conjugated antibody version of this item is also available as catalog #MBS2041461
Preparation and Storage
Store at 4 degree C for frequent use. Stored at -20 degree C to -80 degree C in a manual defrost freezer for one year without detectable loss of activity. Avoid repeated freeze-thaw cycles.

Western Blot (WB)

(Western Blot: Sample: Mouse Spleen lysate; Primary Ab: 3ug/ml Rabbit Anti-Mouse bTG Antibody;Second Ab: 0.2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody;)

Western Blot (WB) (Western Blot: Sample: Mouse Spleen lysate; Primary Ab: 3ug/ml Rabbit Anti-Mouse bTG Antibody;Second Ab: 0.2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody;)

Western Blot (WB)

(Western Blot: Sample: Mouse Serum; Primary Ab: 3ug/ml Rabbit Anti-Mouse bTG Antibody;Second Ab: 0.2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody;(#MBS2086047))

Western Blot (WB) (Western Blot: Sample: Mouse Serum; Primary Ab: 3ug/ml Rabbit Anti-Mouse bTG Antibody;Second Ab: 0.2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody;(#MBS2086047))

Western Blot (WB)

(Western Blot: Sample: Mouse Lung lysate; Primary Ab: 3ug/ml Rabbit Anti-Mouse bTG Antibody;Second Ab: 0.2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody;(#MBS2086047))

Western Blot (WB) (Western Blot: Sample: Mouse Lung lysate; Primary Ab: 3ug/ml Rabbit Anti-Mouse bTG Antibody;Second Ab: 0.2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody;(#MBS2086047))

Western Blot (WB)

(Western Blot: Sample: Recombinant protein)

Western Blot (WB) (Western Blot: Sample: Recombinant protein)

Immunohistochemistry (IHC)

(DAB staining on IHC-P; Samples: Mouse Spleen Tissue))

Immunohistochemistry (IHC) (DAB staining on IHC-P; Samples: Mouse Spleen Tissue))

Immunohistochemistry (IHC)

(DAB staining on fromalin fixed paraffin- embedded lung tissue))

Immunohistochemistry (IHC) (DAB staining on fromalin fixed paraffin- embedded lung tissue))

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12,252 Da
NCBI Official Full Name
platelet basic protein
NCBI Official Synonym Full Names
pro-platelet basic protein
NCBI Official Symbol
Ppbp
NCBI Official Synonym Symbols
TGB; LDGF; MDGF; TGB1; CTAP3; Cxcl7; NAP-2; Scyb7; b-TG1; LA-PF4; THBGB1; CTAPIII; beta-TG; AI854500; NAP-2-L1; 2400003M24Rik
NCBI Protein Information
platelet basic protein
UniProt Protein Name
Chemokine (C-X-C motif) ligand 7, isoform CRA_b
Protein Family
UniProt Gene Name
Ppbp

Research Articles on bTG

Similar Products

Product Notes

The bTG ppbp (Catalog #AAA2001859) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Polyclonal Antibody to Beta-Thromboglobulin (bTG) reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Beta-Thromboglobulin (bTG) can be used in a range of immunoassay formats including, but not limited to, Immunocytochemistry (ICC), Immunohistochemistry (IHC) - Formalin/Paraffin, ELISA (EIA), Western Blot (WB). Western blotting: 1:100-400 Immunocytochemistry in formalin fixed cells: 1:100-500 Immunohistochemistry in formalin fixed frozen section: 1:100-500 Immunohistochemistry in paraffin section: 1:50-200 Enzyme-linked Immunosorbent Assay: 1:100-200. Researchers should empirically determine the suitability of the bTG ppbp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Antigen: The target protein is fused with two N-terminal Tags, His-tag and its sequence is listed below. MGSSHHHHHH SSGLVPRGSH MASMTGGQQM GRGSEF-K SDGMDPYIEL RCRCTNTISG IPFNSISLVN VYRPGVHCAD VEVIATLKNG QKTCLDPNAP GVKRIVMKIL EGY. It is sometimes possible for the material contained within the vial of "Beta-Thromboglobulin (bTG), Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.