Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-BDKRB2 Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)

Rabbit anti-Cow, Human BDKRB2 Polyclonal Antibody | anti-BDKRB2 antibody

BDKRB2 antibody - N-terminal region

Gene Names
BDKRB2; B2R; BK2; BK-2; BKR2; BRB2
Reactivity
Cow, Human
Applications
Western Blot
Purity
Protein A purified
Synonyms
BDKRB2; Polyclonal Antibody; BDKRB2 antibody - N-terminal region; anti-BDKRB2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Human
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQV
Sequence Length
391
Applicable Applications for anti-BDKRB2 antibody
Western Blot (WB)
Homology
Cow: 77%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human BDKRB2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-BDKRB2 Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-BDKRB2 Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-BDKRB2 antibody
This is a rabbit polyclonal antibody against BDKRB2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: BDKRB2 is a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system.This gene encodes a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system. Alternate start codons result in two isoforms of the protein.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
624
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
B2 bradykinin receptor
NCBI Official Synonym Full Names
bradykinin receptor B2
NCBI Official Symbol
BDKRB2
NCBI Official Synonym Symbols
B2R; BK2; BK-2; BKR2; BRB2
NCBI Protein Information
B2 bradykinin receptor
UniProt Protein Name
B2 bradykinin receptor
Protein Family
UniProt Gene Name
BDKRB2
UniProt Synonym Gene Names
BKR2; B2R; BK-2 receptor
UniProt Entry Name
BKRB2_HUMAN

NCBI Description

This gene encodes a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system. Alternate start codons result in two isoforms of the protein. [provided by RefSeq, Jul 2008]

Uniprot Description

BKR2: a receptor for bradykinin. Bradykinin elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system. Alternate start codons result in two isoforms of the protein.

Protein type: Membrane protein, multi-pass; Receptor, GPCR; GPCR, family 1; Membrane protein, integral

Chromosomal Location of Human Ortholog: 14q32.1-q32.2

Cellular Component: integral to plasma membrane; plasma membrane; endosome

Molecular Function: bradykinin receptor activity; protein binding; protease binding; protein heterodimerization activity; type 1 angiotensin receptor binding; phosphoinositide phospholipase C activity

Biological Process: vasoconstriction; metabolic process; blood circulation; negative regulation of peptidyl-serine phosphorylation; arachidonic acid secretion; vasodilation; response to salt stress; G-protein coupled receptor protein signaling pathway; elevation of cytosolic calcium ion concentration; cell surface receptor linked signal transduction; smooth muscle contraction; regulation of vasoconstriction; regulation of vascular permeability; inflammatory response; transmembrane receptor protein tyrosine kinase signaling pathway

Research Articles on BDKRB2

Similar Products

Product Notes

The BDKRB2 bdkrb2 (Catalog #AAA3206032) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BDKRB2 antibody - N-terminal region reacts with Cow, Human and may cross-react with other species as described in the data sheet. AAA Biotech's BDKRB2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BDKRB2 bdkrb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MFSPWKISMF LSVREDSVPT TASFSADMLN VTLQGPTLNG TFAQSKCPQV. It is sometimes possible for the material contained within the vial of "BDKRB2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.