Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (32.34kD).)

Mouse anti-Human BDKRB2 Monoclonal Antibody | anti-BDKRB2 antibody

BDKRB2 (B2 Bradykinin Receptor, B2R, BK-2 Receptor, BKR2) (HRP)

Gene Names
BDKRB2; B2R; BK2; BK-2; BKR2; BRB2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
BDKRB2; Monoclonal Antibody; BDKRB2 (B2 Bradykinin Receptor; B2R; BK-2 Receptor; BKR2) (HRP); anti-BDKRB2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1, lambda
Clone Number
3F6
Specificity
Recognizes human BDKRB2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-BDKRB2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-60 from human BDKRB2 (NP_000614) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQVEWLGWLNTIQ
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.34kD).)

Western Blot (WB) (Western Blot detection against Immunogen (32.34kD).)

Testing Data

(Detection limit for recombinant GST tagged BDKRB2 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged BDKRB2 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-BDKRB2 antibody
Receptor for bradykinin. It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Product Categories/Family for anti-BDKRB2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
624
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
B2 bradykinin receptor
NCBI Official Synonym Full Names
bradykinin receptor B2
NCBI Official Symbol
BDKRB2
NCBI Official Synonym Symbols
B2R; BK2; BK-2; BKR2; BRB2
NCBI Protein Information
B2 bradykinin receptor
UniProt Protein Name
B2 bradykinin receptor
Protein Family
UniProt Gene Name
BDKRB2
UniProt Synonym Gene Names
BKR2; B2R; BK-2 receptor
UniProt Entry Name
BKRB2_HUMAN

NCBI Description

This gene encodes a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system. Alternate start codons result in two isoforms of the protein. [provided by RefSeq, Jul 2008]

Uniprot Description

BKR2: a receptor for bradykinin. Bradykinin elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system. Alternate start codons result in two isoforms of the protein.

Protein type: Membrane protein, multi-pass; Receptor, GPCR; GPCR, family 1; Membrane protein, integral

Chromosomal Location of Human Ortholog: 14q32.1-q32.2

Cellular Component: integral to plasma membrane; plasma membrane; endosome

Molecular Function: bradykinin receptor activity; protein binding; protease binding; protein heterodimerization activity; type 1 angiotensin receptor binding; phosphoinositide phospholipase C activity

Biological Process: vasoconstriction; metabolic process; blood circulation; negative regulation of peptidyl-serine phosphorylation; arachidonic acid secretion; vasodilation; response to salt stress; G-protein coupled receptor protein signaling pathway; elevation of cytosolic calcium ion concentration; cell surface receptor linked signal transduction; smooth muscle contraction; regulation of vasoconstriction; regulation of vascular permeability; inflammatory response; transmembrane receptor protein tyrosine kinase signaling pathway

Research Articles on BDKRB2

Similar Products

Product Notes

The BDKRB2 bdkrb2 (Catalog #AAA6151425) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BDKRB2 (B2 Bradykinin Receptor, B2R, BK-2 Receptor, BKR2) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BDKRB2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BDKRB2 bdkrb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BDKRB2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.