Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of BDKRB2 expression in HELA whole cell lysates (lane 1), HEPG2 whole cell lysates (lane 2), MCF-7 whole cell lysates (lane 3) and A549 whole cell lysates (lane 4). BDKRB2 at 50KD was detected using rabbit anti- BDKRB2 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Rabbit anti-Human BDKRB2 Polyclonal Antibody | anti-BDKRB2 antibody

Anti-BDKRB2 Antibody

Gene Names
BDKRB2; B2R; BK2; BK-2; BKR2; BRB2
Reactivity
Human
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
BDKRB2; Polyclonal Antibody; Anti-BDKRB2 Antibody; B2; B2BKR; B2BRA; B2R; BDKR B2; BDKRB 2; BK 2; BK 2 receptor; BK R2; BK-2 receptor; BK2; BK2 receptor; BK2R; BKR 2; BKR2; BR B2; BRB 2; BRB2; Kinin B2; P30411; B2 bradykinin receptor; bradykinin receptor B2; anti-BDKRB2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
391
Applicable Applications for anti-BDKRB2 antibody
Western Blot (WB)
Application Notes
Western Blot: 0.1-0.5ug/ml
Notes
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human BDKRB2 (357-391aa RSEPIQMENSMGTLRTSISVERQIHKLQDWAGSRQ), different from the related mouse sequence by five amino acids, and from the related rat sequence by seven amino acids.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of BDKRB2 expression in HELA whole cell lysates (lane 1), HEPG2 whole cell lysates (lane 2), MCF-7 whole cell lysates (lane 3) and A549 whole cell lysates (lane 4). BDKRB2 at 50KD was detected using rabbit anti- BDKRB2 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of BDKRB2 expression in HELA whole cell lysates (lane 1), HEPG2 whole cell lysates (lane 2), MCF-7 whole cell lysates (lane 3) and A549 whole cell lysates (lane 4). BDKRB2 at 50KD was detected using rabbit anti- BDKRB2 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Related Product Information for anti-BDKRB2 antibody
Rabbit IgG polyclonal antibody for B2 bradykinin receptor(BDKRB2) detection.
Background: Bradykinin receptor B2 is a G-protein coupled receptor forbradykinin, encoded by the BDKRB2 gene in humans. This gene encodes a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system. Alternate start codons result in two isoforms of the protein.
References
1. Fernandes L, Fortes ZB, Nigro D, Tostes RC, Santos RA, Catelli De Carvalho MH (2001). "Potentiation of bradykinin by angiotensin-(1-7) on arterioles of spontaneously hypertensive rats studied in vivo".Hypertension 37 (2 Part 2): 703-9.
2. Hess JF, Borkowski JA, Young GS, et al. (1992). "Cloning and pharmacological characterization of a human bradykinin (BK-2) receptor.". Biochem. Biophys. Res. Commun. 184 (1): 260-8.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
624
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,441 Da
NCBI Official Full Name
B2 bradykinin receptor
NCBI Official Synonym Full Names
bradykinin receptor B2
NCBI Official Symbol
BDKRB2
NCBI Official Synonym Symbols
B2R; BK2; BK-2; BKR2; BRB2
NCBI Protein Information
B2 bradykinin receptor
UniProt Protein Name
B2 bradykinin receptor
Protein Family
UniProt Gene Name
BDKRB2
UniProt Synonym Gene Names
BKR2; B2R; BK-2 receptor

NCBI Description

This gene encodes a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system. Alternate start codons result in two isoforms of the protein. [provided by RefSeq, Jul 2008]

Uniprot Description

BKR2: a receptor for bradykinin. Bradykinin elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system. Alternate start codons result in two isoforms of the protein.

Protein type: GPCR, family 1; Membrane protein, integral; Membrane protein, multi-pass; Receptor, GPCR

Chromosomal Location of Human Ortholog: 14q32.2

Cellular Component: endosome; integral to plasma membrane; plasma membrane

Molecular Function: bradykinin receptor activity; phosphoinositide phospholipase C activity; protease binding; protein binding; protein heterodimerization activity; type 1 angiotensin receptor binding

Biological Process: arachidonic acid secretion; cell surface receptor linked signal transduction; elevation of cytosolic calcium ion concentration; inflammatory response; regulation of vascular permeability; regulation of vasoconstriction; smooth muscle contraction; transmembrane receptor protein tyrosine kinase signaling pathway

Research Articles on BDKRB2

Similar Products

Product Notes

The BDKRB2 bdkrb2 (Catalog #AAA178803) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-BDKRB2 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BDKRB2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the BDKRB2 bdkrb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BDKRB2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.