Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: BCMO1Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human BCO1 Polyclonal Antibody | anti-BCO1 antibody

BCO1 Antibody - N-terminal region

Gene Names
BCO1; BCO; BCDO; BCMO; BCDO1; BCMO1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
BCO1; Polyclonal Antibody; BCO1 Antibody - N-terminal region; anti-BCO1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GNVLNMGTSIVEKGKTKYVIFKIPATVPEGKKQGKSPWKHTEVFCSIPSR
Sequence Length
547
Applicable Applications for anti-BCO1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human BCMO1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: BCMO1Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: BCMO1Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-BCO1 antibody
This is a rabbit polyclonal antibody against BCMO1. It was validated on Western Blot

Target Description: Vitamin A metabolism is important for vital processes such as vision, embryonic development, cell differentiation, and membrane and skin protection. The protein encoded by this gene is a key enzyme in beta-carotene metabolism to vitamin A. It catalyzes the oxidative cleavage of beta,beta-carotene into two retinal molecules.
Product Categories/Family for anti-BCO1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
beta,beta-carotene 15,15'-dioxygenase
NCBI Official Synonym Full Names
beta-carotene oxygenase 1
NCBI Official Symbol
BCO1
NCBI Official Synonym Symbols
BCO; BCDO; BCMO; BCDO1; BCMO1
NCBI Protein Information
beta,beta-carotene 15,15'-dioxygenase
UniProt Protein Name
Beta,beta-carotene 15,15'-monooxygenase
UniProt Gene Name
BCMO1
UniProt Synonym Gene Names
BCDO; BCDO1
UniProt Entry Name
BCDO1_HUMAN

NCBI Description

Vitamin A metabolism is important for vital processes such as vision, embryonic development, cell differentiation, and membrane and skin protection. The protein encoded by this gene is a key enzyme in beta-carotene metabolism to vitamin A. It catalyzes the oxidative cleavage of beta,beta-carotene into two retinal molecules. [provided by RefSeq, Jul 2008]

Uniprot Description

BCMO1: Symmetrically cleaves beta-carotene into two molecules of retinal. The reaction proceeds in three stages, epoxidation of the 15,15'-double bond, hydration of the double bond leading to ring opening, and oxidative cleavage of the diol formed. Defects in BCMO1 are the cause of autosomal dominant hypercarotenemia and vitamin A deficiency (ADHVAD). Vitamin A is essential for normal embryonic development as well as normal physiological functions in children and adults. Hypercarotenemia is characterized by an excess carotene in the serum, but unlike excess vitamin A, carotene is non-toxic. So far, only a few cases of excess vitamin A have been reported. Individuals were thought to be vitamin A deficient due to an impairment in the conversion of carotenoids to retinal in the intestine. Belongs to the carotenoid oxygenase family.

Protein type: Cofactor and Vitamin Metabolism - retinol; EC 1.14.99.36; Oxidoreductase

Chromosomal Location of Human Ortholog: 16q23.2

Cellular Component: cytosol

Molecular Function: beta-carotene 15,15'-monooxygenase activity; metal ion binding; monooxygenase activity

Biological Process: phototransduction, visible light; vitamin A biosynthetic process; retinal metabolic process; retinol metabolic process; retinoid metabolic process

Disease: Hypercarotenemia And Vitamin A Deficiency, Autosomal Dominant

Research Articles on BCO1

Similar Products

Product Notes

The BCO1 bcmo1 (Catalog #AAA3219672) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BCO1 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BCO1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BCO1 bcmo1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GNVLNMGTSI VEKGKTKYVI FKIPATVPEG KKQGKSPWKH TEVFCSIPSR. It is sometimes possible for the material contained within the vial of "BCO1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.