Western Blot (WB)
(Western Blot analysis of BCL7B expression in transfected 293T cell line by BCL7B polyclonal antibody. Lane 1: BCL7B transfected lysate (22.2kD). Lane 2: Non-transfected lysate.)
Rabbit anti-Human BCL7B Polyclonal Antibody | anti-BCL7B antibody
BCL7B (B Cell CLL/Lymphoma 7 Protein Family Member B, Allergen=Hom s 3) (AP)
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
BCL7B; Polyclonal Antibody; BCL7B (B Cell CLL/Lymphoma 7 Protein Family Member B; Allergen=Hom s 3) (AP); anti-BCL7B antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human BCL7B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-BCL7B antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human BCL7B, aa1-202 (NP_001698.2)
Immunogen Sequence
MSGRSVRAETRSRAKDDIKKVMAAIEKVRKWEKKWVTVGDTSLRIFKWVPVTDSKEKEKSKSNSSAAREPNGFPSDASANSSLLLEFQDENSNQSSVSDVYQLKVDSSTNSSPSPQQSESLSPAHTSDFRTDDSQPPTLGQEILEEPSLPSSEVADEPPTLTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of BCL7B expression in transfected 293T cell line by BCL7B polyclonal antibody. Lane 1: BCL7B transfected lysate (22.2kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of BCL7B expression in transfected 293T cell line by BCL7B polyclonal antibody. Lane 1: BCL7B transfected lysate (22.2kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-BCL7B antibody
May play a role in lung tumor development or progression.
Product Categories/Family for anti-BCL7B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
16,045 Da
NCBI Official Full Name
B-cell CLL/lymphoma 7 protein family member B isoform 1
NCBI Official Synonym Full Names
B-cell CLL/lymphoma 7B
NCBI Official Symbol
BCL7B
NCBI Protein Information
B-cell CLL/lymphoma 7 protein family member B
Protein Family
NCBI Description
This gene encodes a member of the BCL7 family including BCL7A, BCL7B and BCL7C proteins. This member is BCL7B, which contains a region that is highly similar to the N-terminal segment of BCL7A or BCL7C proteins. The BCL7A protein is encoded by the gene known to be directly involved in a three-way gene translocation in a Burkitt lymphoma cell line. This gene is located at a chromosomal region commonly deleted in Williams syndrome. This gene is highly conserved from C. elegans to human. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Oct 2010]
Research Articles on BCL7B
Similar Products
Product Notes
The BCL7B (Catalog #AAA6371145) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BCL7B (B Cell CLL/Lymphoma 7 Protein Family Member B, Allergen=Hom s 3) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BCL7B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BCL7B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BCL7B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
