Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using IFI35 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

Rabbit anti-Human, Mouse IFI35 Polyclonal Antibody | anti-IFI35 antibody

IFI35 Rabbit pAb

Gene Names
IFI35; IFP35
Reactivity
Human, Mouse
Applications
Western Blot, Immunofluorescence
Purity
Affinity purification
Synonyms
IFI35; Polyclonal Antibody; IFI35 Rabbit pAb; IFP35; anti-IFI35 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPLVFRGHTQQDPEVPKSLVSNLRIHCPLLAGSALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPMVTTIQVMMSSQLSGRRVLVTGFPASLRLSEEELLDKLEIFFGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQFTVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNIPDILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGLAVFTSESG
Applicable Applications for anti-IFI35 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
WB: 1:500-1:2000
IF: 1:50-1:100
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-288 of human IFI35 (NP_005524.2).
Cellular Location
Nucleus
Positive Samples
HeLa, HepG2, A-431
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using IFI35 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using IFI35 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Product Categories/Family for anti-IFI35 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31,777 Da
NCBI Official Full Name
interferon-induced 35 kDa protein
NCBI Official Synonym Full Names
interferon-induced protein 35
NCBI Official Symbol
IFI35
NCBI Official Synonym Symbols
IFP35
NCBI Protein Information
interferon-induced 35 kDa protein; IFP 35; ifi-35
UniProt Protein Name
Interferon-induced 35 kDa protein
UniProt Gene Name
IFI35
UniProt Synonym Gene Names
IFP35; IFP 35; Ifi-35
UniProt Entry Name
IN35_HUMAN

Similar Products

Product Notes

The IFI35 ifi35 (Catalog #AAA9142300) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IFI35 Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's IFI35 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). WB: 1:500-1:2000 IF: 1:50-1:100. Researchers should empirically determine the suitability of the IFI35 ifi35 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSAPLDAALH ALQEEQARLK MRLWDLQQLR KELGDSPKDK VPFSVPKIPL VFRGHTQQDP EVPKSLVSNL RIHCPLLAGS ALITFDDPKV AEQVLQQKEH TINMEECRLR VQVQPLELPM VTTIQVMMSS QLSGRRVLVT GFPASLRLSE EELLDKLEIF FGKTRNGGGD VDVRELLPGS VMLGFARDGV AQRLCQIGQF TVPLGGQQVP LRVSPYVNGE IQKAEIRSQP VPRSVLVLNI PDILDGPELH DVLEIHFQKP TRGGGEVEAL TVVPQGQQGL AVFTSESG. It is sometimes possible for the material contained within the vial of "IFI35, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.