Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-BCL2L12 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)

Rabbit BCL2L12 Polyclonal Antibody | anti-BCL2L12 antibody

BCL2L12 antibody - middle region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
BCL2L12; Polyclonal Antibody; BCL2L12 antibody - middle region; anti-BCL2L12 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LEPGPATPDFYALVAQRLEQLVQEQLKSPPSPELQGPPSTEKEAILRRLV
Sequence Length
334
Applicable Applications for anti-BCL2L12 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 79%; Rabbit: 86%; Rat: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-BCL2L12 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)

Western Blot (WB) (WB Suggested Anti-BCL2L12 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)
Related Product Information for anti-BCL2L12 antibody
This is a rabbit polyclonal antibody against BCL2L12. It was validated on Western Blot

Target Description: The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein contains a Bcl-2 homology domain 2 (BH2). The function of this gene has not yet been determined. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
Product Categories/Family for anti-BCL2L12 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
bcl-2-like protein 12 isoform 1
NCBI Official Synonym Full Names
BCL2 like 12
NCBI Official Symbol
BCL2L12
NCBI Protein Information
bcl-2-like protein 12
UniProt Protein Name
Bcl-2-like protein 12
Protein Family
UniProt Gene Name
BCL2L12
UniProt Synonym Gene Names
BPR; Bcl2-L-12
UniProt Entry Name
B2L12_HUMAN

NCBI Description

This gene encodes a member of a family of proteins containing a Bcl-2 homology domain 2 (BH2). The encoded protein is an anti-apoptotic factor that acts as an inhibitor of caspases 3 and 7 in the cytoplasm. In the nucleus, it binds to the p53 tumor suppressor protein, preventing its association with target genes. Overexpression of this gene has been detected in a number of different cancers. There is a pseudogene for this gene on chromosome 3. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013]

Uniprot Description

Bcl-2L12: belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein contains a Bcl-2 homology domain 2 (BH2). The function of this gene has not yet been determined. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]

Protein type: Apoptosis

Chromosomal Location of Human Ortholog: 19q13.3

Cellular Component: membrane; nucleus

Molecular Function: protein binding; p53 binding

Biological Process: positive regulation of transcription from RNA polymerase II promoter

Research Articles on BCL2L12

Similar Products

Product Notes

The BCL2L12 bcl2l12 (Catalog #AAA3215335) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BCL2L12 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's BCL2L12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BCL2L12 bcl2l12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LEPGPATPDF YALVAQRLEQ LVQEQLKSPP SPELQGPPST EKEAILRRLV. It is sometimes possible for the material contained within the vial of "BCL2L12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.