Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of BCL2L10 expression in transfected 293T cell line by BCL2L10 polyclonal antibody. Lane 1: BCL2L10 transfected lysate (23.2kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human BCL2L10 Polyclonal Antibody | anti-BCL2L10 antibody

BCL2L10 (Bcl-2-like Protein 10, Bcl2-L-10, Anti-apoptotic Protein NrH, Apoptosis Regulator Bcl-B, BCLB) (PE)

Gene Names
BCL2L10; Boo; Diva; BCL-B
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
BCL2L10; Polyclonal Antibody; BCL2L10 (Bcl-2-like Protein 10; Bcl2-L-10; Anti-apoptotic Protein NrH; Apoptosis Regulator Bcl-B; BCLB) (PE); anti-BCL2L10 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human BCL2L10.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-BCL2L10 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human BCL2L10, aa1-204 (NP_065129.1).
Immunogen Sequence
MVDQLRERTTMADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSAYLGYPGNRFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARDCQRLVALLSSRLMGQHRAWLQAQGGWDGFCHFFRTPFPLAFWRKQLVQAFLSCLLTTAFIYLWTRLL
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of BCL2L10 expression in transfected 293T cell line by BCL2L10 polyclonal antibody. Lane 1: BCL2L10 transfected lysate (23.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of BCL2L10 expression in transfected 293T cell line by BCL2L10 polyclonal antibody. Lane 1: BCL2L10 transfected lysate (23.2kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-BCL2L10 antibody
Bcl-B (also called Bcl2-L-10) is a novel anti-apoptotic member of the Bcl-2 family. Bcl-B is closest in aa sequence homology to Boo protein. It contains four Bcl-2 homologs. Bcl-B mRNA is widely expressed in adult human tissues. The Bcl-B protein binds to Bcl-2, Bcl-X(L), and Bax but not Bak. Bcl-B suppresses apoptosis induced by Bax, but not by Bak.
Product Categories/Family for anti-BCL2L10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,973 Da
NCBI Official Full Name
bcl-2-like protein 10
NCBI Official Synonym Full Names
BCL2-like 10 (apoptosis facilitator)
NCBI Official Symbol
BCL2L10
NCBI Official Synonym Symbols
Boo; Diva; BCL-B
NCBI Protein Information
bcl-2-like protein 10; anti-apoptotic protein NrH; apoptosis regulator Bcl-B; bcl2-L-10
UniProt Protein Name
Bcl-2-like protein 10
Protein Family
UniProt Gene Name
BCL2L10
UniProt Synonym Gene Names
BCLB; Bcl2-L-10
UniProt Entry Name
B2L10_HUMAN

NCBI Description

The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The protein encoded by this gene contains conserved BH4, BH1 and BH2 domains. This protein can interact with other members of BCL-2 protein family including BCL2, BCL2L1/BCL-X(L), and BAX. Overexpression of this gene has been shown to suppress cell apoptosis possibly through the prevention of cytochrome C release from the mitochondria, and thus activating caspase-3 activation. The mouse counterpart of this protein is found to interact with Apaf1 and forms a protein complex with Caspase 9, which suggests the involvement of this protein in APAF1 and CASPASE 9 related apoptotic pathway. [provided by RefSeq, Jul 2008]

Uniprot Description

BCL2L10: Promotes cell survival. Suppresses apoptosis induced by BAX but not BAK. Binds to Bcl-2, Bcl-X and BAX. Interacts with APAF1. Widely expressed in adult tissues. Preferentially expressed in lung, liver and kidney. Belongs to the Bcl-2 family.

Protein type: Apoptosis; Membrane protein, integral

Chromosomal Location of Human Ortholog: 15q21

Cellular Component: mitochondrial outer membrane; nuclear membrane; mitochondrion; membrane; integral to membrane; cytosol

Molecular Function: protein binding; protein homodimerization activity; protein heterodimerization activity

Biological Process: caspase activation; DNA damage response, signal transduction resulting in induction of apoptosis; female gamete generation; spermatogenesis; negative regulation of apoptosis

Research Articles on BCL2L10

Similar Products

Product Notes

The BCL2L10 bcl2l10 (Catalog #AAA6371122) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BCL2L10 (Bcl-2-like Protein 10, Bcl2-L-10, Anti-apoptotic Protein NrH, Apoptosis Regulator Bcl-B, BCLB) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BCL2L10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BCL2L10 bcl2l10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BCL2L10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.