Rabbit anti-Human BCL2L10 Polyclonal Antibody | anti-BCL2L10 antibody

BCL2L10 (Bcl-2-like Protein 10, Bcl2-L-10, Anti-apoptotic Protein NrH, Apoptosis Regulator Bcl-B, BCLB) (Biotin)

Cat. Num. AAA6371114

• Gene Names: BCL2L10; Boo; Diva; BCL-B
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: BCL2L10; Polyclonal Antibody; BCL2L10 (Bcl-2-like Protein 10; Bcl2-L-10; Anti-apoptotic Protein NrH; Apoptosis Regulator Bcl-B; BCLB) (Biotin); anti-BCL2L10 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human BCL2L10.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-BCL2L10 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human BCL2L10, aa1-204 (NP_065129.1).
• Immunogen Sequence: MVDQLRERTTMADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSAYLGYPGNRFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARDCQRLVALLSSRLMGQHRAWLQAQGGWDGFCHFFRTPFPLAFWRKQLVQAFLSCLLTTAFIYLWTRLL
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of BCL2L10 expression in transfected 293T cell line by BCL2L10 polyclonal antibody. Lane 1: BCL2L10 transfected lysate (23.2kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-BCL2L10 antibody

Bcl-B (also called Bcl2-L-10) is a novel anti-apoptotic member of the Bcl-2 family. Bcl-B is closest in aa sequence homology to Boo protein. It contains four Bcl-2 homologs. Bcl-B mRNA is widely expressed in adult human tissues. The Bcl-B protein binds to Bcl-2, Bcl-X(L), and Bax but not Bak. Bcl-B suppresses apoptosis induced by Bax, but not by Bak.

Product Categories/Family for anti-BCL2L10 antibody

Antibodies; Apoptosis

NCBI and Uniprot Product Information

• NCBI GI #: 9966783
• NCBI GeneID: 10017
• NCBI Accession #: NP_065129.1
• NCBI GenBank Nucleotide #: NM_020396
• UniProt Accession #: Q9HD36; Q3SX80; Q52LQ9; Q8TCS9
• Molecular Weight: 21,973 Da
• NCBI Official Full Name: bcl-2-like protein 10
• NCBI Official Synonym Full Names: BCL2-like 10 (apoptosis facilitator)
• NCBI Official Symbol: BCL2L10
• NCBI Official Synonym Symbols: Boo; Diva; BCL-B
• NCBI Protein Information: bcl-2-like protein 10; anti-apoptotic protein NrH; apoptosis regulator Bcl-B; bcl2-L-10
• UniProt Protein Name: Bcl-2-like protein 10
• Protein Family: Bcl-2-like protein
• UniProt Gene Name: BCL2L10
• UniProt Synonym Gene Names: BCLB; Bcl2-L-10
• UniProt Entry Name: B2L10_HUMAN

NCBI Description

The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The protein encoded by this gene contains conserved BH4, BH1 and BH2 domains. This protein can interact with other members of BCL-2 protein family including BCL2, BCL2L1/BCL-X(L), and BAX. Overexpression of this gene has been shown to suppress cell apoptosis possibly through the prevention of cytochrome C release from the mitochondria, and thus activating caspase-3 activation. The mouse counterpart of this protein is found to interact with Apaf1 and forms a protein complex with Caspase 9, which suggests the involvement of this protein in APAF1 and CASPASE 9 related apoptotic pathway. [provided by RefSeq, Jul 2008]

Uniprot Description

BCL2L10: Promotes cell survival. Suppresses apoptosis induced by BAX but not BAK. Binds to Bcl-2, Bcl-X and BAX. Interacts with APAF1. Widely expressed in adult tissues. Preferentially expressed in lung, liver and kidney. Belongs to the Bcl-2 family.

Protein type: Apoptosis; Membrane protein, integral

Chromosomal Location of Human Ortholog: 15q21

Cellular Component: mitochondrial outer membrane; nuclear membrane; mitochondrion; membrane; integral to membrane; cytosol

Molecular Function: protein binding; protein homodimerization activity; protein heterodimerization activity

Biological Process: caspase activation; DNA damage response, signal transduction resulting in induction of apoptosis; female gamete generation; spermatogenesis; negative regulation of apoptosis