Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: BCAP31Sample Tissue: Mouse Small IntestineAntibody Dilution: 1ug/ml)

Rabbit BCAP31 Polyclonal Antibody | anti-BCAP31 antibody

BCAP31 antibody - middle region

Gene Names
BCAP31; CDM; DDCH; BAP31; 6C6-AG; DXS1357E
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
BCAP31; Polyclonal Antibody; BCAP31 antibody - middle region; anti-BCAP31 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: STKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE
Sequence Length
246
Applicable Applications for anti-BCAP31 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human BCAP31
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: BCAP31Sample Tissue: Mouse Small IntestineAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: BCAP31Sample Tissue: Mouse Small IntestineAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: BCAP31Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: BCAP31Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: BCAP31Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: BCAP31Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-BCAP31 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysate)

Western Blot (WB) (WB Suggested Anti-BCAP31 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysate)
Related Product Information for anti-BCAP31 antibody
This is a rabbit polyclonal antibody against BCAP31. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: BCAP31 is a member of the B-cell receptor associated protein 31 superfamily. It is a multi-pass transmembrane protein of the endoplasmic reticulum that is involved in the anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi and in the caspase 8-mediated apoptosis. Microdeletions in this gene are associated with the contiguous ABCD1/DXS1375E deletion syndrome.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
B-cell receptor-associated protein 31 isoform b
NCBI Official Synonym Full Names
B cell receptor associated protein 31
NCBI Official Symbol
BCAP31
NCBI Official Synonym Symbols
CDM; DDCH; BAP31; 6C6-AG; DXS1357E
NCBI Protein Information
B-cell receptor-associated protein 31
UniProt Protein Name
B-cell receptor-associated protein 31
UniProt Gene Name
BCAP31
UniProt Synonym Gene Names
BAP31; DXS1357E; BCR-associated protein 31; Bap31
UniProt Entry Name
BAP31_HUMAN

NCBI Description

This gene encodes a member of the B-cell receptor associated protein 31 superfamily. The encoded protein is a multi-pass transmembrane protein of the endoplasmic reticulum that is involved in the anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi and in caspase 8-mediated apoptosis. Microdeletions in this gene are associated with contiguous ABCD1/DXS1375E deletion syndrome (CADDS), a neonatal disorder. Alternative splicing of this gene results in multiple transcript variants. Two related pseudogenes have been identified on chromosome 16. [provided by RefSeq, Jan 2012]

Uniprot Description

BCAP31 iso2: May play a role in anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi. May be involved in CASP8-mediated apoptosis. Homodimer and heterodimer with BCAP29. Binds CASP8 (isoform 9) as a complex containing BCAP31, BCAP29, BCL2 and/or BCL2L1. Interacts with VAMP3, VAMP1 and membrane IgD immunoglobulins. May interact with ACTG1 and non-muscle myosin II. Interacts with PTPLB. Ubiquitous. Belongs to the BCAP29/BCAP31 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: endoplasmic reticulum membrane; ER-Golgi intermediate compartment membrane; clathrin-coated vesicle; membrane; endoplasmic reticulum; integral to plasma membrane; lipid particle; cytosol

Molecular Function: protein binding; MHC class I protein binding; protein complex binding

Biological Process: intracellular protein transport; elevation of cytosolic calcium ion concentration; antigen processing and presentation of peptide antigen via MHC class I; ER to Golgi vesicle-mediated transport; apoptosis; reduction of endoplasmic reticulum calcium ion concentration; positive regulation of caspase activity; spermatogenesis; elevation of mitochondrial calcium ion concentration; cell structure disassembly during apoptosis

Disease: Deafness, Dystonia, And Cerebral Hypomyelination

Research Articles on BCAP31

Similar Products

Product Notes

The BCAP31 bcap31 (Catalog #AAA3208277) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BCAP31 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's BCAP31 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BCAP31 bcap31 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: STKQKLEKAE NQVLAMRKQS EGLTKEYDRL LEEHAKLQAA VDGPMDKKEE. It is sometimes possible for the material contained within the vial of "BCAP31, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.