Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of BBS9 expression in transfected 293T cell line by BBS9 MaxPab polyclonal antibody.Lane 1: BBS9 transfected lysate(34.80 KDa).Lane 2: Non-transfected lysate.)

Rabbit anti-Human BBS9 Polyclonal Antibody | anti-BBS9 antibody

BBS9 (Bardet-Biedl Syndrome 9, B1, C18, D1, MGC118917, PTHB1) (FITC)

Gene Names
BBS9; B1; D1; C18; PTHB1
Reactivity
Human
Applications
Western Blot
Purity
Purified
Synonyms
BBS9; Polyclonal Antibody; BBS9 (Bardet-Biedl Syndrome 9; B1; C18; D1; MGC118917; PTHB1) (FITC); Bardet-Biedl Syndrome 9; PTHB1; anti-BBS9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human BBS9.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-BBS9 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
BBS9 (AAH32715.1, 1aa-310aa) full-length human protein.
Immunogen Sequence
MGYLRIFSPHPAKTGDGAQAEDLLLEVDLRDPVLQVEVGKFVSGTEMLHLAVLHSRKLCVYSVSGTLGNVEHGNQCQMKLMYEHNLQRTACNMTYGSFGGVKGRDLICIQSMDGMLMVFEQESYAFGRFLPGFLLPGPLAYSSRTDSFLTVSSCQQVESYKYQVLAFATDADKRQETEQQKLGSGKRLVVDWTLNIGEQALDICIVSFNQSASSVFVLGERNFFCLKDNGQIRFMKKLDWSPSCFLPYCSVSEGTINTLIGNHNNMLHIYQDVTLKWATQLPHIPVAVRVGCLQFSLWKHLLPRSSTLEK
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

Western Blot (WB)

(Western Blot analysis of BBS9 expression in transfected 293T cell line by BBS9 MaxPab polyclonal antibody.Lane 1: BBS9 transfected lysate(34.80 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of BBS9 expression in transfected 293T cell line by BBS9 MaxPab polyclonal antibody.Lane 1: BBS9 transfected lysate(34.80 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-BBS9 antibody
This gene is downregulated by parathyroid hormone in osteoblastic cells, and therefore, is thought to be involved in parathyroid hormone action in bones. The exact function of this gene has not yet been determined. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]
Product Categories/Family for anti-BBS9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
98,683 Da
NCBI Official Full Name
BBS9 protein
NCBI Official Synonym Full Names
Bardet-Biedl syndrome 9
NCBI Official Symbol
BBS9
NCBI Official Synonym Symbols
B1; D1; C18; PTHB1
NCBI Protein Information
protein PTHB1
Protein Family

NCBI Description

This gene is downregulated by parathyroid hormone in osteoblastic cells, and therefore, is thought to be involved in parathyroid hormone action in bones. The exact function of this gene has not yet been determined. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Research Articles on BBS9

Similar Products

Product Notes

The BBS9 (Catalog #AAA6450577) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BBS9 (Bardet-Biedl Syndrome 9, B1, C18, D1, MGC118917, PTHB1) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BBS9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BBS9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BBS9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.