SDS-PAGE
Homeobox protein Nkx-3.2 (Nkx3-2) Recombinant Protein | Nkx3-2 recombinant protein
Recombinant Mouse Homeobox protein Nkx-3.2 (Nkx3-2)
Gene Names
Nkx3-2; Bapx1; NKX3.2; Nkx-3.2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Homeobox protein Nkx-3.2 (Nkx3-2); Recombinant Mouse Homeobox protein Nkx-3.2 (Nkx3-2); Bagpipe homeobox protein homolog 1; Homeobox protein NK-3 homolog B; Nkx3-2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-333aa; Full Length
Sequence
MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPAPGGTEVAVTAAPAVCCWRIFGETEAGALGGAEDSLLASPARTRTAVGQSAESPGGWDSDSALSEENEGRRRCADVPGASGTGRARVTLGLDQPGCELHAAKDLEEEAPVRSDSEMSASVSGDHSPRGEDDSVSPGGARVPGLRGAAGSGASGGQAGGVEEEEEPAAPKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPYYCLPGWALSTCAAAAGTQ
Sequence Length
333
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for Nkx3-2 recombinant protein
Transcriptional repressor that acts as a negative regulator of chondrocyte maturation. PLays a role in distal stomach development; required for proper antral-pyloric morphogenesis and development of antral-type epithelium. In concert with GSC, defines the structural components of the middle ear; required for tympanic ring and gonium development and in the regulation of the width of the malleus.
Product Categories/Family for Nkx3-2 recombinant protein
References
"Bapx1 regulates patterning in the middle ear: altered regulatory role in the transition from the proximal jaw during vertebrate evolution." Tucker A.S., Watson R.P., Lettice L.A., Yamada G., Hill R.E. Development 131:1235-1245(2004)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
35.2 kDa
NCBI Official Full Name
homeobox protein Nkx-3.2
NCBI Official Synonym Full Names
NK3 homeobox 2
NCBI Official Symbol
Nkx3-2
NCBI Official Synonym Symbols
Bapx1; NKX3.2; Nkx-3.2
NCBI Protein Information
homeobox protein Nkx-3.2
UniProt Protein Name
Homeobox protein Nkx-3.2
Protein Family
UniProt Gene Name
Nkx3-2
UniProt Synonym Gene Names
Bapx1; Nkx-3.2; Nkx3b
Uniprot Description
Transcriptional repressor that acts as a negative regulator of chondrocyte maturation. PLays a role in distal stomach development; required for proper antral-pyloric morphogenesis and development of antral-type epithelium. In concert with GSC, defines the structural components of the middle ear; required for tympanic ring and gonium development and in the regulation of the width of the malleus.
Research Articles on Nkx3-2
Similar Products
Product Notes
The Nkx3-2 nkx3-2 (Catalog #AAA7056465) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-333aa; Full Length. The amino acid sequence is listed below: MAVRGSGTLT PFSIQAILNK KEERGGLATP EGRPAPGGTE VAVTAAPAVC CWRIFGETEA GALGGAEDSL LASPARTRTA VGQSAESPGG WDSDSALSEE NEGRRRCADV PGASGTGRAR VTLGLDQPGC ELHAAKDLEE EAPVRSDSEM SASVSGDHSP RGEDDSVSPG GARVPGLRGA AGSGASGGQA GGVEEEEEPA APKPRKKRSR AAFSHAQVFE LERRFNHQRY LSGPERADLA ASLKLTETQV KIWFQNRRYK TKRRQMAADL LASAPAAKKV AVKVLVRDDQ RQYLPGEVLR PPSLLPLQPS YYYPYYCLPG WALSTCAAAA GTQ. It is sometimes possible for the material contained within the vial of "Homeobox protein Nkx-3.2 (Nkx3-2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
