Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-BAG4 AntibodyTitration: 1.0 ug/mlPositive Control: RPMI-8226 Whole Cell)

Rabbit BAG4 Polyclonal Antibody | anti-BAG4 antibody

BAG4 antibody - C-terminal region

Gene Names
BAG4; SODD; BAG-4
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
BAG4; Polyclonal Antibody; BAG4 antibody - C-terminal region; anti-BAG4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EVEEFVGKKTDKAYWLLEEMLTKELLELDSVETGGQDSVRQARKEAVCKI
Sequence Length
457
Applicable Applications for anti-BAG4 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 92%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-BAG4 AntibodyTitration: 1.0 ug/mlPositive Control: RPMI-8226 Whole Cell)

Western Blot (WB) (WB Suggested Anti-BAG4 AntibodyTitration: 1.0 ug/mlPositive Control: RPMI-8226 Whole Cell)
Related Product Information for anti-BAG4 antibody
This is a rabbit polyclonal antibody against BAG4. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the BAG1-related protein family. BAG1 is an anti-apoptotic protein that functions through interactions with a variety of cell apoptosis and growth related proteins including BCL-2, Raf-protein kinase, steroid hormone receptors, growth factor receptors and members of the heat shock protein 70 kDa family. This protein contains a BAG domain near the C-terminus, which could bind and inhibit the chaperone activity of Hsc70/Hsp70. This protein was found to be associated with the death domain of tumor necrosis factor receptor type 1 (TNF-R1) and death receptor-3 (DR3), and thereby negatively regulates downstream cell death signaling. The regulatory role of this protein in cell death was demonstrated in epithelial cells which undergo apoptosis while integrin mediated matrix contacts are lost. Alternatively spliced transcript variants encoding distinct isoforms have been identified.
Product Categories/Family for anti-BAG4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
BAG family molecular chaperone regulator 4 isoform 1
NCBI Official Synonym Full Names
BCL2 associated athanogene 4
NCBI Official Symbol
BAG4
NCBI Official Synonym Symbols
SODD; BAG-4
NCBI Protein Information
BAG family molecular chaperone regulator 4
UniProt Protein Name
BAG family molecular chaperone regulator 4
UniProt Gene Name
BAG4
UniProt Synonym Gene Names
SODD; BAG-4
UniProt Entry Name
BAG4_HUMAN

NCBI Description

The protein encoded by this gene is a member of the BAG1-related protein family. BAG1 is an anti-apoptotic protein that functions through interactions with a variety of cell apoptosis and growth related proteins including BCL-2, Raf-protein kinase, steroid hormone receptors, growth factor receptors and members of the heat shock protein 70 kDa family. This protein contains a BAG domain near the C-terminus, which could bind and inhibit the chaperone activity of Hsc70/Hsp70. This protein was found to be associated with the death domain of tumor necrosis factor receptor type 1 (TNF-R1) and death receptor-3 (DR3), and thereby negatively regulates downstream cell death signaling. The regulatory role of this protein in cell death was demonstrated in epithelial cells which undergo apoptosis while integrin mediated matrix contacts are lost. Alternatively spliced transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Mar 2011]

Uniprot Description

BAG4: Inhibits the chaperone activity of HSP70/HSC70 by promoting substrate release. Prevents constitutive TNFRSF1A signaling. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis

Chromosomal Location of Human Ortholog: 8p11.23

Cellular Component: plasma membrane; nucleus; cytosol

Molecular Function: protein binding; chaperone binding; receptor signaling protein activity

Biological Process: positive regulation of protein kinase B signaling cascade; positive regulation of cell adhesion; protein folding; positive regulation of actin filament polymerization; protein heterooligomerization; positive regulation of stress fiber formation; positive regulation of peptidyl-serine phosphorylation; negative regulation of apoptosis

Research Articles on BAG4

Similar Products

Product Notes

The BAG4 bag4 (Catalog #AAA3215404) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BAG4 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's BAG4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BAG4 bag4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EVEEFVGKKT DKAYWLLEEM LTKELLELDS VETGGQDSVR QARKEAVCKI. It is sometimes possible for the material contained within the vial of "BAG4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.