Rabbit anti-Human, Mouse BAFF Receptor Polyclonal Antibody | anti-BAFFR antibody

BAFF Receptor (BAFFR, BAFF-R, B Cell-activating Factor Receptor, BLyS Receptor 3, BR3, BROMIX, CD268, CVID4, MGC138235, Prolixin, Tumor Necrosis Factor Receptor Superfamily Member 13C, TNFRSF13C) (PE)

Cat. Num. AAA6370935

• Gene Names: TNFRSF13C; BAFFR; CD268; CVID4; BAFF-R; BROMIX; prolixin
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: BAFF Receptor; Polyclonal Antibody; BAFF Receptor (BAFFR; BAFF-R; B Cell-activating Factor Receptor; BLyS Receptor 3; BR3; BROMIX; CD268; CVID4; MGC138235; Prolixin; Tumor Necrosis Factor Receptor Superfamily Member 13C; TNFRSF13C) (PE); anti-BAFFR antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human BAFF Receptor. Species Crossreactivity: mouse
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-BAFFR antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length protein corresponding to aa 1-184 from human BAFF Receptor.
• Immunogen Sequence: MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ
• Conjugate: PE
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of BAFF Receptor expression in mouse kidney using 123803.)

Western Blot (WB)

(Western Blot analysis of BAFF Receptor expression in transfected 293T cell line using 123803. Lane 1: TNFRSF13C transfected lysate (18.9kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-BAFFR antibody

B cell-activating factor receptor (BAFF-R) is a 19kD type III membrane protein. It belongs to the TNFR superfamily also known as TNFRSF member 13C (TNFRSF13C), BAFF receptor 3 (BR3), or CD268. BAFF-R is expressed on mature B cells, B cell lymphoma, and T cell subset. BAFF-R is the major receptor for BAFF/BLys (or TALL-1, THANK), which binds to TACI and BCMA as well. The interaction of BAFF with BAFF-R promotes NF-k B activation and plays a major role in B-cell maturation and survival, as well as costimulates T cell activation and proliferation. TRAF3 is a BAFF-R intracellularly associated protein, which negatively regulates BAFF-R-mediated NF-k B activation.

Product Categories/Family for anti-BAFFR antibody

Antibodies; Growth Factors; Cytokines

NCBI and Uniprot Product Information

• NCBI GI #: 16445027
• NCBI GeneID: 115650
• NCBI Accession #: NP_443177.1
• NCBI GenBank Nucleotide #: NM_052945.2
• UniProt Accession #: Q96RJ3
• Molecular Weight: 18,935 Da
• NCBI Official Full Name: tumor necrosis factor receptor superfamily member 13C
• NCBI Official Synonym Full Names: tumor necrosis factor receptor superfamily, member 13C
• NCBI Official Symbol: TNFRSF13C
• NCBI Official Synonym Symbols: BAFFR; CD268; CVID4; BAFF-R; BROMIX; prolixin
• NCBI Protein Information: tumor necrosis factor receptor superfamily member 13C; B cell-activating factor receptor; B-cell-activating factor receptor; BAFF receptor; BLyS receptor 3
• UniProt Protein Name: Tumor necrosis factor receptor superfamily member 13C
• UniProt Gene Name: TNFRSF13C
• UniProt Synonym Gene Names: BAFFR; BR3; BAFF-R
• UniProt Entry Name: TR13C_HUMAN

NCBI Description

B cell-activating factor (BAFF) enhances B-cell survival in vitro and is a regulator of the peripheral B-cell population. Overexpression of Baff in mice results in mature B-cell hyperplasia and symptoms of systemic lupus erythematosus (SLE). Also, some SLE patients have increased levels of BAFF in serum. Therefore, it has been proposed that abnormally high levels of BAFF may contribute to the pathogenesis of autoimmune diseases by enhancing the survival of autoreactive B cells. The protein encoded by this gene is a receptor for BAFF and is a type III transmembrane protein containing a single extracellular cysteine-rich domain. It is thought that this receptor is the principal receptor required for BAFF-mediated mature B-cell survival. [provided by RefSeq, Jul 2008]

Uniprot Description

BAFF-R: B-cell receptor specific for TNFSF13B/TALL1/BAFF/BLyS. Promotes the survival of mature B-cells and the B-cell response. Defects in TNFRSF13C are the cause of immunodeficiency common variable type 4 (CVID4); also called antibody deficiency due to BAFFR defect. CVID4 is a primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The defect results from a failure of B-cell differentiation and impaired secretion of immunoglobulins; the numbers of circulating B-cells is usually in the normal range, but can be low. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, misc.; Cell cycle regulation; Cell surface; Membrane protein, integral

Chromosomal Location of Human Ortholog: 22q13.1-q13.31

Cellular Component: integral to membrane; external side of plasma membrane

Biological Process: B cell costimulation; B cell homeostasis; T cell costimulation; positive regulation of germinal center formation; positive regulation of B cell proliferation; positive regulation of T cell proliferation; positive regulation of interferon-gamma biosynthetic process

Disease: Immunodeficiency, Common Variable, 2; Immunodeficiency, Common Variable, 4