Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human, Mouse BAFF Receptor Polyclonal Antibody | anti-BAFFR antibody

BAFF Receptor (BAFFR, BAFF-R, B Cell-activating Factor Receptor, BLyS Receptor 3, BR3, BROMIX, CD268, CVID4, MGC138235, Prolixin, Tumor Necrosis Factor Receptor Superfamily Member 13C, TNFRSF13C) (MaxLight 650)

Gene Names
TNFRSF13C; BAFFR; CD268; CVID4; BAFF-R; BROMIX; prolixin
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
BAFF Receptor; Polyclonal Antibody; BAFF Receptor (BAFFR; BAFF-R; B Cell-activating Factor Receptor; BLyS Receptor 3; BR3; BROMIX; CD268; CVID4; MGC138235; Prolixin; Tumor Necrosis Factor Receptor Superfamily Member 13C; TNFRSF13C) (MaxLight 650); anti-BAFFR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human BAFF Receptor. Species Crossreactivity: mouse
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-BAFFR antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length protein corresponding to aa 1-184 from human BAFF Receptor.
Immunogen Sequence
MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ
Conjugate
MaxLight650
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-BAFFR antibody
B cell-activating factor receptor (BAFF-R) is a 19kD type III membrane protein. It belongs to the TNFR superfamily also known as TNFRSF member 13C (TNFRSF13C), BAFF receptor 3 (BR3), or CD268. BAFF-R is expressed on mature B cells, B cell lymphoma, and T cell subset. BAFF-R is the major receptor for BAFF/BLys (or TALL-1, THANK), which binds to TACI and BCMA as well. The interaction of BAFF with BAFF-R promotes NF-k B activation and plays a major role in B-cell maturation and survival, as well as costimulates T cell activation and proliferation. TRAF3 is a BAFF-R intracellularly associated protein, which negatively regulates BAFF-R-mediated NF-k B activation.
Product Categories/Family for anti-BAFFR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18,935 Da
NCBI Official Full Name
tumor necrosis factor receptor superfamily member 13C
NCBI Official Synonym Full Names
tumor necrosis factor receptor superfamily, member 13C
NCBI Official Symbol
TNFRSF13C
NCBI Official Synonym Symbols
BAFFR; CD268; CVID4; BAFF-R; BROMIX; prolixin
NCBI Protein Information
tumor necrosis factor receptor superfamily member 13C; B cell-activating factor receptor; B-cell-activating factor receptor; BAFF receptor; BLyS receptor 3
UniProt Protein Name
Tumor necrosis factor receptor superfamily member 13C
UniProt Gene Name
TNFRSF13C
UniProt Synonym Gene Names
BAFFR; BR3; BAFF-R
UniProt Entry Name
TR13C_HUMAN

NCBI Description

B cell-activating factor (BAFF) enhances B-cell survival in vitro and is a regulator of the peripheral B-cell population. Overexpression of Baff in mice results in mature B-cell hyperplasia and symptoms of systemic lupus erythematosus (SLE). Also, some SLE patients have increased levels of BAFF in serum. Therefore, it has been proposed that abnormally high levels of BAFF may contribute to the pathogenesis of autoimmune diseases by enhancing the survival of autoreactive B cells. The protein encoded by this gene is a receptor for BAFF and is a type III transmembrane protein containing a single extracellular cysteine-rich domain. It is thought that this receptor is the principal receptor required for BAFF-mediated mature B-cell survival. [provided by RefSeq, Jul 2008]

Uniprot Description

BAFF-R: B-cell receptor specific for TNFSF13B/TALL1/BAFF/BLyS. Promotes the survival of mature B-cells and the B-cell response. Defects in TNFRSF13C are the cause of immunodeficiency common variable type 4 (CVID4); also called antibody deficiency due to BAFFR defect. CVID4 is a primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The defect results from a failure of B-cell differentiation and impaired secretion of immunoglobulins; the numbers of circulating B-cells is usually in the normal range, but can be low. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, misc.; Cell cycle regulation; Cell surface; Membrane protein, integral

Chromosomal Location of Human Ortholog: 22q13.1-q13.31

Cellular Component: integral to membrane; external side of plasma membrane

Biological Process: B cell costimulation; B cell homeostasis; T cell costimulation; positive regulation of germinal center formation; positive regulation of B cell proliferation; positive regulation of T cell proliferation; positive regulation of interferon-gamma biosynthetic process

Disease: Immunodeficiency, Common Variable, 2; Immunodeficiency, Common Variable, 4

Research Articles on BAFFR

Similar Products

Product Notes

The BAFFR tnfrsf13c (Catalog #AAA6370933) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BAFF Receptor (BAFFR, BAFF-R, B Cell-activating Factor Receptor, BLyS Receptor 3, BR3, BROMIX, CD268, CVID4, MGC138235, Prolixin, Tumor Necrosis Factor Receptor Superfamily Member 13C, TNFRSF13C) (MaxLight 650) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's BAFF Receptor can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BAFFR tnfrsf13c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BAFF Receptor, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.