Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-BACE2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: ACHN cell lysateBACE2 is supported by BioGPS gene expression data to be expressed in ACHN)

Rabbit BACE2 Polyclonal Antibody | anti-BACE2 antibody

BACE2 antibody - middle region

Gene Names
BACE2; ASP1; BAE2; DRAP; AEPLC; ALP56; ASP21; CDA13; CEAP1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
BACE2; Polyclonal Antibody; BACE2 antibody - middle region; anti-BACE2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGF
Sequence Length
396
Applicable Applications for anti-BACE2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 85%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human BACE2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-BACE2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: ACHN cell lysateBACE2 is supported by BioGPS gene expression data to be expressed in ACHN)

Western Blot (WB) (WB Suggested Anti-BACE2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: ACHN cell lysateBACE2 is supported by BioGPS gene expression data to be expressed in ACHN)
Related Product Information for anti-BACE2 antibody
This is a rabbit polyclonal antibody against BACE2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease and a frequent complication of Down syndrome. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein by 2 proteases, one of which is the protein encoded by this gene. This gene localizes to the 'Down critical region' of chromosome 21. The encoded protein, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease. Three transcript variants encoding different isoforms have been described for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
beta-secretase 2 isoform B preproprotein
NCBI Official Synonym Full Names
beta-secretase 2
NCBI Official Symbol
BACE2
NCBI Official Synonym Symbols
ASP1; BAE2; DRAP; AEPLC; ALP56; ASP21; CDA13; CEAP1
NCBI Protein Information
beta-secretase 2
UniProt Protein Name
Beta-secretase 2
Protein Family
UniProt Gene Name
BACE2
UniProt Synonym Gene Names
AEPLC; ALP56; ASP21; ASP1; Asp 1; Beta-site APP cleaving enzyme 2; DRAP
UniProt Entry Name
BACE2_HUMAN

NCBI Description

This gene encodes an integral membrane glycoprotein that functions as an aspartic protease. The encoded protein cleaves amyloid precursor protein into amyloid beta peptide, which is a critical step in the etiology of Alzheimer's disease and Down syndrome. The protein precursor is further processed into an active mature peptide. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]

Uniprot Description

BACE2: Responsible for the proteolytic processing of the amyloid precursor protein (APP). Cleaves APP, between residues 690 and 691, leading to the generation and extracellular release of beta-cleaved soluble APP, and a corresponding cell-associated C- terminal fragment which is later released by gamma-secretase. It has also been shown that it can cleave APP between residues 671 and 672. Belongs to the peptidase A1 family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.4.23.45; Protease; Membrane protein, integral

Chromosomal Location of Human Ortholog: 21q22.3

Cellular Component: Golgi apparatus; cell surface; endoplasmic reticulum; integral to membrane; endosome

Molecular Function: aspartic-type endopeptidase activity

Biological Process: negative regulation of amyloid precursor protein biosynthetic process; membrane protein ectodomain proteolysis; peptide hormone processing; proteolysis

Research Articles on BACE2

Similar Products

Product Notes

The BACE2 bace2 (Catalog #AAA3208358) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BACE2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's BACE2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BACE2 bace2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SLNLDCREYN ADKAIVDSGT TLLRLPQKVF DAVVEAVARA SLIPEFSDGF. It is sometimes possible for the material contained within the vial of "BACE2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.