Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of ATTY expression in rat spleen extract (lane 1), mouse liver extract (lane 2) and A549 whole cell lysates (lane 3). ATTY at 42KD was detected using rabbit anti- ATTY Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Rabbit ATTY Polyclonal Antibody | anti-TAT antibody

Anti-ATTY Antibody

Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
ATTY; Polyclonal Antibody; Anti-ATTY Antibody; TAT; Tyrosine aminotransferase; P17735; anti-TAT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
454
Applicable Applications for anti-TAT antibody
Western Blot (WB)
Application Notes
Western Blot: 0.1-0.5ug/ml
Notes
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human ATTY (169-208aa FSLYKTLAESMGIEVKLYNLLPEKSWEIDLKQLEYLIDEK), different from the related mouse and rat sequences by two amino acids.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of ATTY expression in rat spleen extract (lane 1), mouse liver extract (lane 2) and A549 whole cell lysates (lane 3). ATTY at 42KD was detected using rabbit anti- ATTY Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of ATTY expression in rat spleen extract (lane 1), mouse liver extract (lane 2) and A549 whole cell lysates (lane 3). ATTY at 42KD was detected using rabbit anti- ATTY Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Related Product Information for anti-TAT antibody
Rabbit IgG polyclonal antibody for Tyrosine aminotransferase(TAT) detection.
Background: This nuclear gene encodes a mitochondrial protein tyrosine aminotransferase which is present in the liver and catalyzes the conversion of L-tyrosine into p-hydroxyphenylpyruvate. Mutations in this gene cause tyrosinemia (type II, Richner-Hanhart syndrome), a disorder accompanied by major skin and corneal lesions, with possible mental retardation. A regulator gene for tyrosine aminotransferase is X-linked.
References
1. Natt E, Kida K, Odievre M, Di Rocco M, Scherer G (October 1992). "Point mutations in the tyrosine aminotransferase gene in tyrosinemia type II". Proc. Natl. Acad. Sci. U.S.A. 89 (19): 9297-301.
2. Rettenmeier R, Natt E, Zentgraf H, Scherer G (July 1990). "Isolation and characterization of the human tyrosine aminotransferase gene". Nucleic Acids Res. 18 (13): 3853-61.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,399 Da
NCBI Official Full Name
tyrosine aminotransferase
NCBI Official Synonym Full Names
tyrosine aminotransferase
NCBI Official Symbol
TAT
NCBI Protein Information
tyrosine aminotransferase
UniProt Protein Name
Tyrosine aminotransferase
Protein Family
UniProt Gene Name
TAT
UniProt Synonym Gene Names
TAT

NCBI Description

This nuclear gene encodes a mitochondrial protein tyrosine aminotransferase which is present in the liver and catalyzes the conversion of L-tyrosine into p-hydroxyphenylpyruvate. Mutations in this gene cause tyrosinemia (type II, Richner-Hanhart syndrome), a disorder accompanied by major skin and corneal lesions, with possible mental retardation. A regulator gene for tyrosine aminotransferase is X-linked. [provided by RefSeq, Jul 2008]

Uniprot Description

TAT: Transaminase involved in tyrosine breakdown. Converts tyrosine to p-hydroxyphenylpyruvate. Can catalyze the reverse reaction, using glutamic acid, with 2-oxoglutarate as cosubstrate (in vitro). Has much lower affinity and transaminase activity towards phenylalanine. Defects in TAT are the cause of tyrosinemia type 2 (TYRO2); also known as Richner-Hanhart syndrome. TYRO2 is an inborn error of metabolism characterized by elevations of tyrosine in the blood and urine, and oculocutaneous manifestations. Typical features include palmoplantar keratosis, painful corneal ulcers, and mental retardation. Belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family.

Protein type: Amino Acid Metabolism - cysteine and methionine; Amino Acid Metabolism - phenylalanine; Amino Acid Metabolism - phenylalanine, tyrosine and tryptophan biosynthesis; Amino Acid Metabolism - tyrosine; Cofactor and Vitamin Metabolism - ubiquinone and other terpenoid-quinone biosynthesis; EC 2.6.1.5; Mitochondrial; Transferase

Chromosomal Location of Human Ortholog: 16q22.2

Cellular Component: cytosol

Molecular Function: tyrosine transaminase activity

Biological Process: 2-oxoglutarate metabolic process; glutamate metabolic process; L-phenylalanine catabolic process; tyrosine catabolic process

Disease: Tyrosinemia, Type Ii

Research Articles on TAT

Similar Products

Product Notes

The TAT tat (Catalog #AAA178615) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-ATTY Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ATTY can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the TAT tat for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ATTY, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.