Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: VATE1Sample Type: OVCAR-3 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit ATP6V1E1 Polyclonal Antibody | anti-ATP6V1E1 antibody

ATP6V1E1 Antibody - N-terminal region

Gene Names
ATP6V1E1; P31; Vma4; ATP6E; ARCL2C; ATP6E2; ATP6V1E
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity purified
Synonyms
ATP6V1E1; Polyclonal Antibody; ATP6V1E1 Antibody - N-terminal region; anti-ATP6V1E1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQK
Sequence Length
226
Applicable Applications for anti-ATP6V1E1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human VATE1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: VATE1Sample Type: OVCAR-3 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: VATE1Sample Type: OVCAR-3 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ATP6V1E1 antibody
This is a rabbit polyclonal antibody against VATE1. It was validated on Western Blot

Target Description: This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. This gene encodes alternate transcriptional splice variants, encoding different V1 domain E subunit isoforms. Pseudogenes for this gene have been found in the genome.
Product Categories/Family for anti-ATP6V1E1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
529
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
V-type proton ATPase subunit E 1 isoform a
NCBI Official Synonym Full Names
ATPase H+ transporting V1 subunit E1
NCBI Official Symbol
ATP6V1E1
NCBI Official Synonym Symbols
P31; Vma4; ATP6E; ARCL2C; ATP6E2; ATP6V1E
NCBI Protein Information
V-type proton ATPase subunit E 1
UniProt Protein Name
V-type proton ATPase subunit e 1
UniProt Gene Name
ATP6V0E1
UniProt Synonym Gene Names
ATP6H; ATP6V0E; V-ATPase subunit e 1
UniProt Entry Name
VA0E1_HUMAN

NCBI Description

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. This gene encodes alternate transcriptional splice variants, encoding different V1 domain E subunit isoforms. Pseudogenes for this gene have been found in the genome. [provided by RefSeq, Jul 2008]

Uniprot Description

ATP6V0E1: Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. Belongs to the V-ATPase e1/e2 subunit family.

Protein type: Transporter, ion channel; Membrane protein, integral; Transporter, iron; Transporter; Hydrolase; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 5q35.1

Cellular Component: phagocytic vesicle membrane; membrane; integral to membrane; endosome membrane

Molecular Function: ATPase activity, coupled to transmembrane movement of ions; transporter activity; hydrogen ion transporting ATPase activity, rotational mechanism

Biological Process: interaction with host; vacuolar acidification; proton transport; cellular iron ion homeostasis; metabolic process; ATP hydrolysis coupled proton transport; insulin receptor signaling pathway; transferrin transport; response to amino acid stimulus; cell growth; transmembrane transport

Research Articles on ATP6V1E1

Similar Products

Product Notes

The ATP6V1E1 atp6v0e1 (Catalog #AAA3208909) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATP6V1E1 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ATP6V1E1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ATP6V1E1 atp6v0e1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IEQEANEKAE EIDAKAEEEF NIEKGRLVQT QRLKIMEYYE KKEKQIEQQK. It is sometimes possible for the material contained within the vial of "ATP6V1E1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.