SULT2A1 Polyclonal Antibody | anti-SULT2A1 antibody

Anti-SULT2A1 Antibody

Cat. Num. AAA177742

• Gene Names: SULT2A1; HST; ST2; STD; hSTa; DHEAS; ST2A1; ST2A3; DHEA-ST
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: SULT2A1; Polyclonal Antibody; Anti-SULT2A1 Antibody; Bile salt sulfotransferase; Alcohol/hydroxysteroid sulfotransferase; Bile salt sulfotranasferase 2A1; Dehydroepiandrosterone sulfotransferase; DHEA ST; DHEA sulfotranasferase; DHEA-ST; DHEAS; EC 2.8.2.14; Hst; hSTa; Hydroxysteroid sulfotransferase; ST2; ST2A1; ST2A1_HUMAN; ST2A3; STD; sulfotranasferase; dehydroepiandrosterone-preferring; Sulfotransferase 2A1; Sulfotransferase family 2A; member 1; Sulfotransferase family cytosolic 2A dehydroepiandrosterone (DHEA) preferring member 1; Sult2a1; sulfotransferase family 2A member 1; anti-SULT2A1 antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 285

• Applicable Applications for anti-SULT2A1 antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SULT2A1 (253-285aa DWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE), different from the related mouse sequence by seven amino acids, and from the related rat sequence by eight amino acids.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- SULT2A1 Picoband antibody, MBS177742, Western blottingAll lanes: Anti SULT2A1 (MBS177742) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Rat Kidney Tissue Lysate at 50ugLane 3: Mouse Liver Tissue Lysate at 50ugLane 4: Mouse Kidney Tissue Lysate at 50ugLane 5: HELA Whole Cell Lysate at 40ugLane 6: SW620 Whole Cell Lysate at 40ugPredicted bind size: 34KDObserved bind size: 34KD)

Immunohistochemistry (IHC)

(Anti- SULT2A1 Picoband antibody, MBS177742, IHC(P)IHC(P): Mouse Liver Tissue)

Immunohistochemistry (IHC)

(Anti- SULT2A1 Picoband antibody, MBS177742, IHC(P)IHC(P): Rat Liver Tissue)

Immunohistochemistry (IHC)

(Anti- SULT2A1 Picoband antibody, MBS177742, IHC(P)IHC(P): Human Renal Cancer Tissue)

Related Product Information for anti-SULT2A1 antibody

Description: Rabbit IgG polyclonal antibody for Bile salt sulfotransferase(SULT2A1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Bile salt sulfotransferase, also known as hydroxysteroid sulfotransferase (HST) or sulfotransferase 2A1 (ST2A1), is an enzyme that in humans is encoded by the SULT2A1 gene. It is mapped to 19q13.3. This gene encodes a member of the sulfotransferase family. Sulfotransferases aid in the metabolism of drugs and endogenous compounds by converting these substances into more hydrophilic water-soluble sulfate conjugates that can be easily excreted. This protein catalyzes the sulfation of steroids and bile acids in the liver and adrenal glands, and may have a role in the inherited adrenal androgen excess in women with polycystic ovary syndrome.

References

1. "Entrez Gene: SULT2A1 sulfotransferase family, cytosolic, 2A, dehydroepiandrosterone (DHEA)-preferring, member 1". 2. Otterness DM, Wieben ED, Wood TC, Watson WG, Madden BJ, McCormick DJ, Weinshilboum RM (May 1992). "Human liver dehydroepiandrosterone sulfotransferase: molecular cloning and expression of cDNA". Mol. Pharmacol. 41(5): 865-72. 3. Otterness DM, Mohrenweiser HW, Brandriff BF, Weinshilboum RM (1995). "Dehydroepiandrosterone sulfotransferase gene (STD): localization to human chromosome band 19q13.3". Cytogenet. Cell Genet. 70 (1-2): 45-7.

NCBI and Uniprot Product Information

• NCBI GI #: 29540545
• NCBI GeneID: 6822
• NCBI Accession #: NP_003158.2
• NCBI GenBank Nucleotide #: NM_003167.3
• UniProt Accession #: Q06520
• Molecular Weight: 33,780 Da
• NCBI Official Full Name: bile salt sulfotransferase
• NCBI Official Synonym Full Names: sulfotransferase family 2A member 1
• NCBI Official Symbol: SULT2A1
• NCBI Official Synonym Symbols: HST; ST2; STD; hSTa; DHEAS; ST2A1; ST2A3; DHEA-ST
• NCBI Protein Information: bile salt sulfotransferase
• UniProt Protein Name: Bile salt sulfotransferase
• Protein Family: Bile salt sulfotransferase
• UniProt Gene Name: SULT2A1
• UniProt Synonym Gene Names: HST; STD; DHEA-ST; HST; ST2A1
• UniProt Entry Name: ST2A1_HUMAN

NCBI Description

This gene encodes a member of the sulfotransferase family. Sulfotransferases aid in the metabolism of drugs and endogenous compounds by converting these substances into more hydrophilic water-soluble sulfate conjugates that can be easily excreted. This protein catalyzes the sulfation of steroids and bile acids in the liver and adrenal glands, and may have a role in the inherited adrenal androgen excess in women with polycystic ovary syndrome. [provided by RefSeq, Mar 2010]

Uniprot Description

SULT2A1: Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfonation of steroids and bile acids in the liver and adrenal glands. Belongs to the sulfotransferase 1 family.

Protein type: EC 2.8.2.14; Transferase

Chromosomal Location of Human Ortholog: 19q13.3

Cellular Component: cytoplasm; cytosol

Molecular Function: aryl sulfotransferase activity; bile-salt sulfotransferase activity; estrone sulfotransferase activity; protein binding; steroid sulfotransferase activity; sulfotransferase activity

Biological Process: 3'-phosphoadenosine 5'-phosphosulfate metabolic process; bile acid catabolic process; digestion; steroid metabolic process; sulfation