Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using ATP2C1 Antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)

Rabbit ATP2C1 Polyclonal Antibody | anti-ATP2C1 antibody

ATP2C1

Gene Names
ATP2C1; HHD; BCPM; PMR1; SPCA1; hSPCA1; ATP2C1A
Applications
Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity Purification
Synonyms
ATP2C1; Polyclonal Antibody; anti-ATP2C1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
AVSRIVEAGCVCNDAVIRNNTLMGKPTEGALIALAMKMGLDGLQQDYIRKAEYPFSSEQKWMAVKCVHRTQQDRPEICFMKGAYEQVIKYCTTYQSKGQTLTLTQQQRDVYQQEKARMGSAGLRVLALASGPELGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSKTSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVA
Sequence Length
919
Applicable Applications for anti-ATP2C1 antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunofluoresence (IF)
Application Notes
WB 1:500 - 1:2000
IHC 1:50 - 1:200
IF 1:50 - 1:200
Species
Human
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 400-660 of human ATP2C1 (NP_001186114.1).
Cross Reactivity
Human, Mouse, Rat
Preparation and Storage
Store at -20°C. Avoid freeze / thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using ATP2C1 Antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using ATP2C1 Antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded mouse lung using ATP2C1 antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded mouse lung using ATP2C1 antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded rat brain using ATP2C1 antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded rat brain using ATP2C1 antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded human stomach using ATP2C1 antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded human stomach using ATP2C1 antibody at dilution of 1:100 (40x lens).)
Related Product Information for anti-ATP2C1 antibody
The protein encoded by this gene belongs to the family of P-type cation transport ATPases. This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium ions. Defects in this gene cause Hailey-Hailey disease, an autosomal dominant disorder. Alternatively spliced transcript variants encoding different isoforms have been identified.
Product Categories/Family for anti-ATP2C1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
Observed MW: 100kDa
Calculated MW: 96-107kDa
NCBI Official Full Name
Calcium-transporting ATPase type 2C member 1
NCBI Official Synonym Full Names
ATPase, Ca++ transporting, type 2C, member 1
NCBI Official Symbol
ATP2C1
NCBI Official Synonym Symbols
HHD; BCPM; PMR1; SPCA1; hSPCA1; ATP2C1A
NCBI Protein Information
calcium-transporting ATPase type 2C member 1; HUSSY-28; ATPase 2C1; ATPase, Ca(2+)-sequestering; ATP-dependent Ca(2+) pump PMR1; secretory pathway Ca2+/Mn2+ ATPase 1
UniProt Protein Name
Calcium-transporting ATPase type 2C member 1
UniProt Gene Name
ATP2C1
UniProt Synonym Gene Names
KIAA1347; PMR1L; ATPase 2C1
UniProt Entry Name
AT2C1_HUMAN

NCBI Description

The protein encoded by this gene belongs to the family of P-type cation transport ATPases. This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium ions. Defects in this gene cause Hailey-Hailey disease, an autosomal dominant disorder. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2011]

Uniprot Description

ATP2C1: This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of the calcium. Defects in ATP2C1 are the cause of Hailey-Hailey disease (HHD); also known as benign familial pemphigus. HHD is an autosomal dominant disorder characterized by persistent blisters and suprabasal cell separation (acantholysis) of the epidermis, due to impaired keratinocyte adhesion. Patients lacking all isoforms except isoform 2 have HHD. Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIA subfamily. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter; Hydrolase; Membrane protein, multi-pass; Membrane protein, integral; Transporter, ion channel; EC 3.6.3.8

Chromosomal Location of Human Ortholog: 3q22.1

Cellular Component: Golgi membrane; Golgi apparatus; membrane; integral to membrane; trans-Golgi network

Molecular Function: manganese-transporting ATPase activity; signal transducer activity; calcium-transporting ATPase activity; manganese ion binding; metal ion binding; calcium ion binding; ATP binding

Biological Process: cellular calcium ion homeostasis; Golgi calcium ion homeostasis; epidermis development; positive regulation of I-kappaB kinase/NF-kappaB cascade; metabolic process; calcium ion transport; calcium-dependent cell-cell adhesion; actin cytoskeleton reorganization; manganese ion transport; cellular manganese ion homeostasis; signal transduction; Golgi calcium ion transport; transmembrane transport

Disease: Benign Chronic Pemphigus

Research Articles on ATP2C1

Similar Products

Product Notes

The ATP2C1 atp2c1 (Catalog #AAA126611) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ATP2C1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunofluoresence (IF). WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200. Researchers should empirically determine the suitability of the ATP2C1 atp2c1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AVSRIVEAGC VCNDAVIRNN TLMGKPTEGA LIALAMKMGL DGLQQDYIRK AEYPFSSEQK WMAVKCVHRT QQDRPEICFM KGAYEQVIKY CTTYQSKGQT LTLTQQQRDV YQQEKARMGS AGLRVLALAS GPELGQLTFL GLVGIIDPPR TGVKEAVTTL IASGVSIKMI TGDSQETAVA IASRLGLYSK TSQSVSGEEI DAMDVQQLSQ IVPKVAVFYR ASPRHKMKII KSLQKNGSVV AMTGDGVNDA VALKAADIGV A. It is sometimes possible for the material contained within the vial of "ATP2C1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.