Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of TNFSF15 expression in transfected 293T cell line by TNFSF15 polyclonal antibody. Lane 1: TNFSF15 transfected lysate (28.1kD). Lane 2: Non-transfected lysate. )

Rabbit anti-Human TNFSF15 Polyclonal Antibody | anti-TNFSF15 antibody

TNFSF15 (Tumor Necrosis Factor Ligand Superfamily Member 15, TNF Ligand-related Molecule 1, TL1, TL1A, Vascular Endothelial Cell Growth Inhibitor, VEGI, VEGI192A) (Biotin)

Gene Names
TNFSF15; TL1; TL1A; VEGI; VEGI192A
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TNFSF15; Polyclonal Antibody; TNFSF15 (Tumor Necrosis Factor Ligand Superfamily Member 15; TNF Ligand-related Molecule 1; TL1; TL1A; Vascular Endothelial Cell Growth Inhibitor; VEGI; VEGI192A) (Biotin); anti-TNFSF15 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TNFSF15.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-TNFSF15 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length protein corresponding to aa1-251 from human TNFSF15.
Immunogen Sequence
MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of TNFSF15 expression in transfected 293T cell line by TNFSF15 polyclonal antibody. Lane 1: TNFSF15 transfected lysate (28.1kD). Lane 2: Non-transfected lysate. )

Western Blot (WB) (Western Blot analysis of TNFSF15 expression in transfected 293T cell line by TNFSF15 polyclonal antibody. Lane 1: TNFSF15 transfected lysate (28.1kD). Lane 2: Non-transfected lysate. )
Product Categories/Family for anti-TNFSF15 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,131 Da
NCBI Official Full Name
tumor necrosis factor ligand superfamily member 15 isoform VEGI-251
NCBI Official Synonym Full Names
tumor necrosis factor (ligand) superfamily, member 15
NCBI Official Symbol
TNFSF15
NCBI Official Synonym Symbols
TL1; TL1A; VEGI; VEGI192A
NCBI Protein Information
tumor necrosis factor ligand superfamily member 15; TNF superfamily ligand TL1A; TNF ligand-related molecule 1; vascular endothelial cell growth inhibitor; vascular endothelial growth inhibitor-192A
UniProt Protein Name
Tumor necrosis factor ligand superfamily member 15
UniProt Gene Name
TNFSF15
UniProt Synonym Gene Names
TL1; VEGI
UniProt Entry Name
TNF15_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is abundantly expressed in endothelial cells, but is not expressed in either B or T cells. The expression of this protein is inducible by TNF and IL-1 alpha. This cytokine is a ligand for receptor TNFRSF25 and decoy receptor TNFRSF21/DR6. It can activate NF-kappaB and MAP kinases, and acts as an autocrine factor to induce apoptosis in endothelial cells. This cytokine is also found to inhibit endothelial cell proliferation, and thus may function as an angiogenesis inhibitor. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2011]

Uniprot Description

TNFSF15: Receptor for TNFRSF25 and TNFRSF6B. Mediates activation of NF-kappa-B. Inhibits vascular endothelial growth and angiogenesis (in vitro). Promotes activation of caspases and apoptosis. Belongs to the tumor necrosis factor family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytokine; Membrane protein, integral; Apoptosis

Chromosomal Location of Human Ortholog: 9q32

Cellular Component: extracellular space; integral to plasma membrane; plasma membrane; integral to membrane

Molecular Function: death receptor binding; cytokine activity; tumor necrosis factor receptor binding; receptor binding

Biological Process: caspase activation; cytokine metabolic process; activation of NF-kappaB-inducing kinase; immune response; signal transduction; positive regulation of cytokine secretion

Research Articles on TNFSF15

Similar Products

Product Notes

The TNFSF15 tnfsf15 (Catalog #AAA6396755) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TNFSF15 (Tumor Necrosis Factor Ligand Superfamily Member 15, TNF Ligand-related Molecule 1, TL1, TL1A, Vascular Endothelial Cell Growth Inhibitor, VEGI, VEGI192A) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TNFSF15 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TNFSF15 tnfsf15 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TNFSF15, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.