Rabbit anti-Human ATP11C Polyclonal Antibody | anti-ATP11C antibody

Anti-ATP11C Antibody

Cat. Num. AAA1753137

• Gene Names: ATP11C; ATPIG; ATPIQ; HACXL
• Reactivity: Human
• Applications: Western Blot, Immunocytochemistry, Immunofluorescence, Flow Cytometry, Functional Assay
• Purity: Immunogen affinity purified.
• Synonyms: ATP11C; Polyclonal Antibody; Anti-ATP11C Antibody; Phospholipid-transporting ATPase IG (EC:7.6.2.1); ATPase IQ; ATPase class VI type 11C; P4-ATPase flippase complex alpha subunit ATP11C; ATPIG; ATPIQ; anti-ATP11C antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: No cross reactivity with other proteins.
• Purity/Purification: Immunogen affinity purified.
• Form/Format: Lyophilized; Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 1119

• Applicable Applications for anti-ATP11C antibody: Western Blot (WB), Immunocytochemistry (ICC), Immunofluorescence (IF), Flow Cytometry (FC/FACS)
• Application Notes: WB: 0.1-0.25ug/ml (Human); ICC: 2ug/ml (Human); IF: 2ug/ml (Human); FC/FACS: 1-3ug/1x106 cells (Human); Tested Species: In-house tested species with positive results.
• Immunogen: A synthetic peptide corresponding to a sequence of human ATP11C (QNHEIELTKVHVERNAMDGYRTLCVAFKEIAPDDYER).
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen store at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Flow Cytometry (FC/FACS)

Immunofluorescence (IF)

Western Blot (WB)

(Figure 1. Western blot analysis of ATP11C using anti-ATP11C antibody.)

Related Product Information for anti-ATP11C antibody

Description: Rabbit IgG polyclonal antibody for ATP11C detection. Tested with WB, ICC/IF, FCM in Human.

Background: ATP11C is an enzyme that in humans is encoded by the ATP11C gene. This gene is mapped to Xq27.1.

References

1. Arashiki, N., Takakuwa, Y., Mohandas, N., Hale, J., Yoshida, K., Ogura, H., Utsugisawa, T., Ohga, S., Miyano, S., Ogawa, S., Kojima, S., Kanno, H. ATP11C is a major flippase in human erythrocytes and its defect causes congenital hemolytic anemia. Haematologica 101: 559-565, 2016.
2. Nesbit, M. A., Bowl, M. R., Harding, B., Schlessinger, D., Whyte, M. P., Thakker, R. V. X-linked hypoparathyroidism region on Xq27 is evolutionarily conserved with regions on 3q26 and 13q34 and contains a novel P-type ATPase. Genomics 84: 1060-1070, 2004.
3. Segawa, K., Kurata, S., Yanagihashi, Y., Brummelkamp, T. R., Matsuda, F., Nagata, S. Caspase-mediated cleavage of phospholipid flippase for apoptotic phosphatidylserine exposure. Science 344: 1164-1168, 2014.

NCBI and Uniprot Product Information

• NCBI GI #: 58331222
• NCBI GeneID: 286410
• NCBI Accession #: NP_001010986.1
• NCBI GenBank Nucleotide #: NP_001010986.1
• UniProt Accession #: Q8NB49
• NCBI Official Full Name: phospholipid-transporting ATPase IG isoform b
• NCBI Official Synonym Full Names: ATPase phospholipid transporting 11C
• NCBI Official Symbol: ATP11C
• NCBI Official Synonym Symbols: ATPIG; ATPIQ; HACXL
• NCBI Protein Information: phospholipid-transporting ATPase IG
• UniProt Protein Name: Phospholipid-transporting ATPase IG
• Protein Family: Phospholipid-transporting ATPase
• UniProt Gene Name: ATP11C
• UniProt Synonym Gene Names: ATPIG; ATPIQ
• UniProt Entry Name: AT11C_HUMAN