Western Blot (WB)
(ATP10D antibody (MBS5300298) used at 1 ug/ml to detect target protein.)
Rabbit ATP10D Polyclonal Antibody | anti-ATP10D antibody
ATP10D antibody
Gene Names
ATP10D; ATPVD
Applications
Western Blot
Purity
Affinity purified
Synonyms
ATP10D; Polyclonal Antibody; ATP10D antibody; Polyclonal ATP10D; Anti-ATP10D; ATPVD; Atpase Class V Type 10D; KIAA1487; anti-ATP10D antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
ATP10D antibody was raised against the C terminal of ATP10D
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ATP10D antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
535
Applicable Applications for anti-ATP10D antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
ATP10D is a multi-pass membrane protein. It belongs to the cation transport ATPase (P-type) family, type IV subfamily. The exact function of ATP10D remains unknown.
Cross-Reactivity
Human
Immunogen
ATP10D antibody was raised using the C terminal of ATP10D corresponding to a region with amino acids LFTSAPPVIYGVLEKDVSAETLMQLPELYRSGQKSEAYLPHTFWITLLDA
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(ATP10D antibody (MBS5300298) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(ATP10D antibody (MBS5300298) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-ATP10D antibody
Rabbit polyclonal ATP10D antibody raised against the C terminal of ATP10D
Product Categories/Family for anti-ATP10D antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
160 kDa (MW of target protein)
NCBI Official Full Name
ATP10D protein
NCBI Official Synonym Full Names
ATPase, class V, type 10D
NCBI Official Symbol
ATP10D
NCBI Official Synonym Symbols
ATPVD
NCBI Protein Information
probable phospholipid-transporting ATPase VD
UniProt Protein Name
Probable phospholipid-transporting ATPase VD
Protein Family
UniProt Gene Name
ATP10D
UniProt Synonym Gene Names
ATPVD; KIAA1487
UniProt Entry Name
AT10D_HUMAN
Uniprot Description
ATP10D: Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IV subfamily. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Hydrolase; Membrane protein, integral; EC 3.6.3.1; Transporter; Membrane protein, multi-pass; Transporter, ion channel
Chromosomal Location of Human Ortholog: 4p12
Cellular Component: nucleoplasm; endoplasmic reticulum membrane; endoplasmic reticulum; integral to membrane; plasma membrane
Molecular Function: phospholipid-translocating ATPase activity; protein binding; magnesium ion binding; ATP binding
Biological Process: phospholipid translocation; intracellular protein transport; metabolic process; transmembrane transport; cation transport
Research Articles on ATP10D
Similar Products
Product Notes
The ATP10D atp10d (Catalog #AAA5300298) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ATP10D can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the ATP10D atp10d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ATP10D, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
