Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Immunohistochemistry with Liver cell lysate tissue)

Rabbit ATOH1 Polyclonal Antibody | anti-ATOH1 antibody

ATOH1 antibody - middle region

Gene Names
ATOH1; ATH1; HATH1; MATH-1; bHLHa14
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
ATOH1; Polyclonal Antibody; ATOH1 antibody - middle region; anti-ATOH1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRS
Sequence Length
354
Applicable Applications for anti-ATOH1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 92%; Dog: 85%; Horse: 85%; Human: 100%; Mouse: 92%; Pig: 92%; Rabbit: 83%; Rat: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ATOH1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Immunohistochemistry with Liver cell lysate tissue)

Immunohistochemistry (IHC) (Immunohistochemistry with Liver cell lysate tissue)

Immunohistochemistry (IHC)

(Immunohistochemistry with Spleen cell lysate tissue)

Immunohistochemistry (IHC) (Immunohistochemistry with Spleen cell lysate tissue)

Immunohistochemistry (IHC)

(Immunohistochemistry with Spleen cell lysate tissue)

Immunohistochemistry (IHC) (Immunohistochemistry with Spleen cell lysate tissue)

Immunohistochemistry (IHC)

(mouse cochlea)

Immunohistochemistry (IHC) (mouse cochlea)

Western Blot (WB)

(Host: RabbitTarget Name: ATOH1Sample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ATOH1Sample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ATOH1Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ATOH1Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ATOH1Sample Type: PlacentaLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/laneGel Concentration: 0.12%)

Western Blot (WB) (Host: RabbitTarget Name: ATOH1Sample Type: PlacentaLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/laneGel Concentration: 0.12%)

Western Blot (WB)

(WB Suggested Anti-ATOH1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Placenta)

Western Blot (WB) (WB Suggested Anti-ATOH1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Placenta)
Related Product Information for anti-ATOH1 antibody
This is a rabbit polyclonal antibody against ATOH1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ATOH1 belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47.This protein belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
474
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
protein atonal homolog 1
NCBI Official Synonym Full Names
atonal bHLH transcription factor 1
NCBI Official Symbol
ATOH1
NCBI Official Synonym Symbols
ATH1; HATH1; MATH-1; bHLHa14
NCBI Protein Information
protein atonal homolog 1
UniProt Protein Name
Protein atonal homolog 1
Protein Family
UniProt Gene Name
ATOH1
UniProt Synonym Gene Names
ATH1; BHLHA14; bHLHa14; hATH1
UniProt Entry Name
ATOH1_HUMAN

NCBI Description

This protein belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47. [provided by RefSeq, Jul 2008]

Uniprot Description

ATOH1: a conserved transcription factor that regulates secretory cell differentiation in colonic epithelium. Activates E box-dependent transcription in collaboration with TCF3/E47, but the activity is completely antagonized by the negative regulator of neurogenesis HES1. May play a role in the differentiation of subsets of neural cells by activating E box- dependent transcription . Efficient DNA binding requires dimerization with another bHLH protein. Loss of ATOH1 expression in the colon of mice initiates colon cancer. ATOH1 has been silenced in most human colon cancers, and reactivation of this gene in cultured human colon cancer cells is anti-proliferative and induces apoptosis.

Protein type: DNA-binding; Transcription factor; Cell development/differentiation

Chromosomal Location of Human Ortholog: 4q22

Cellular Component: nucleus

Molecular Function: protein dimerization activity; chromatin DNA binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; axon guidance; inner ear morphogenesis; central nervous system development; auditory receptor cell fate determination; neuron migration; positive regulation of transcription from RNA polymerase II promoter; positive regulation of auditory receptor cell differentiation; auditory receptor cell fate specification; cerebral cortex development; positive regulation of neuron differentiation; negative regulation of apoptosis

Research Articles on ATOH1

Similar Products

Product Notes

The ATOH1 atoh1 (Catalog #AAA3200889) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATOH1 antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ATOH1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the ATOH1 atoh1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QLDALHFSTF EDSALTAMMA QKNLSPSLPG SILQPVQEEN SKTSPRSHRS. It is sometimes possible for the material contained within the vial of "ATOH1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.